DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or71a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster


Alignment Length:308 Identity:55/308 - (17%)
Similarity:120/308 - (38%) Gaps:64/308 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 RKEPEMF----RKVDGKMIINRLVSAMYGAVISLYLIAPVFSIINQSKDFLYSMIFPFD-SDPL- 179
            ::|.:|:    |:.:...:...|.||   .||...:|.|:|.|.|:...::::   ||| ..|: 
  Fly   111 KQEVDMWRFEHRRFNRVFMFYCLCSA---GVIPFIVIQPLFDIPNRLPFWMWT---PFDWQQPVL 169

  Fly   180 --YIF------VPLLLTNVWVGIVIDTMMFGETNLLCELIVHLNGSYMLLKRDLQLAIEKILVAR 236
              |.|      :|:...   ..:.:|.:.:       .|::||:    |..|.|...:.|:    
  Fly   170 FWYAFIYQATTIPIACA---CNVTMDAVNW-------YLMLHLS----LCLRMLGQRLSKL---- 216

  Fly   237 DRPHMAKQLKVLITKTLRKNVALNQFGQQLEAQYTVRVFIMFAFAAGLLCALSFKAYTNP----- 296
              .|..|.|:....:.:..:..|.|....:|...:...|.....::.::|...:....:|     
  Fly   217 --QHDDKDLREKFLELIHLHQRLKQQALSIEIFISKSTFTQILVSSLIICFTIYSMQMSPVLQDL 279

  Fly   297 -----MANYIYAIWFGAKTVELLSLGQIGSDLAFTTDSLSTMYYLTHWEQILQYSTNPSENLRLL 356
                 |..|:.|:     .::::.....|:.:..:.:.|:...|.:.|         |..|.|:.
  Fly   280 PGFAAMMQYLVAM-----IMQVMLPTIYGNAVIDSANMLTDSMYNSDW---------PDMNCRMR 330

  Fly   357 KLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTSMQR 404
            :|:.:.:...::|..:....:|.:.|....|.:..::|....|.:|.:
  Fly   331 RLVLMFMVYLNRPVTLKAGGFFHIGLPLFTKTMNQAYSLLALLLNMNQ 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 52/295 (18%)
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 52/295 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466204
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.