DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or67b

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:417 Identity:83/417 - (19%)
Similarity:160/417 - (38%) Gaps:103/417 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VLAVAMSLVFMQHNDAELRYLRFEASNRNLDAFLTGMPTYLI----LVEAQFRSLHI------LL 100
            ||.|.:|:::                  :|.||:  |..|:|    .|||...:..:      :.
  Fly    51 VLIVNLSIIY------------------SLVAFI--MENYMISFETYVEAVLLTFQLSVGVVKMF 95

  Fly   101 HFE----------------KLQKFLEIFYANIYIDPRKEPEMFRKV-----DGKMIINRLVSAMY 144
            ||:                ::.|.|.:|..::   |||: |:...|     :..|||:|.|...:
  Fly    96 HFQNKVESCSQLVFSTETGEVLKSLGLFQLDL---PRKK-ELLSSVSLILLNNWMIIDRQVMFFF 156

  Fly   145 GAV---ISLYLIAPVFSII----NQSKD-----FLYSMIFPF-----DSDPLYIFVPLLLTN--V 190
            ..|   :..|.:.|.|..|    .:.||     ..|..|.|:     ...|.|:....||.:  :
  Fly   157 KIVCMPVLYYCVRPYFQYIFDCYIKDKDTCEMTLTYPAIVPYLQLGNYEFPSYVIRFFLLQSGPL 221

  Fly   191 WVGIVIDTMMFGETNLLCELIVHLNGSYMLLKRDLQLAIEKILVARDRPHMAKQLKVLITKTLRK 255
            |....:    ||..:|...|..:.:|...:|:..:|.:...|||.:|:  ..|.|:..:    |.
  Fly   222 WCFFAV----FGFNSLFVVLTRYESGLIKVLRFLVQNSTSDILVPKDQ--RVKYLQCCV----RL 276

  Fly   256 NVALNQFGQQLEAQYTVRVFIMFAFAAGLLCALSFKAYTNPMANYIYAIWFGAKTVELLSLGQIG 320
            ...::....|:|..:...:.:..:.::.|:|.|.:|..|.....:   :|.|...|..:::.   
  Fly   277 FARISSHHNQIENLFKYIILVQCSVSSILICMLLYKISTVLEVGW---VWMGMIMVYFVTIA--- 335

  Fly   321 SDLAFTTDSLSTM------YYLTH-WEQILQYSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYF 378
              |..|..::|..      ..|.| |.....|  |.|...:.  :|.:.:..:.:.|.::...:.
  Fly   336 --LEITLYNVSAQKVESQSELLFHDWYNCSWY--NESREFKF--MIKMMLLFSRRTFVLSVGGFT 394

  Fly   379 RVSLQAGLKILQASFSYFTFLTSMQRR 405
            .:|.:..:::.:.|.::|..|.:|..:
  Fly   395 SLSHKFLVQVFRLSANFFLLLRNMNNK 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 75/375 (20%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 42/232 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465380
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.