DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or67a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster


Alignment Length:298 Identity:61/298 - (20%)
Similarity:108/298 - (36%) Gaps:73/298 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 LVSAMYGA----VISLYLIAPVFSIINQSKDFL-YSMIFPFDSDPLYIFVPLLLTNVWVG----- 193
            |...||.|    .:.:|.|..|......:|..: :..:.|::....::|.|........|     
  Fly   147 LFMIMYFAHALIPLFIYFIQRVLLHYPDAKQIMPFYQLEPWEFRDSWLFYPSYFHQSSAGYTATC 211

  Fly   194 --IVIDTMMFGETNLLCELIVHLNGSYMLLKRDLQLAIEKILVARDRPHMAKQ----LKVLITK- 251
              |..|.|:|.   ::.::|:|    |..|.:.|:   |..:.|.:.|:.||:    |:.|:.. 
  Fly   212 GSIAGDLMIFA---VVLQVIMH----YERLAKVLR---EFKIQAHNAPNGAKEDIRKLQSLVANH 266

  Fly   252 --TLRKNVALNQ-FGQQLEAQYTVRVFIMFAFAAGLLCALSFKAYTNPMANYIYAIWFGAKTVEL 313
              .||....:|: ||        :.:.:.|..:|.|:|.:                  |.:....
  Fly   267 IDILRLTDLMNEVFG--------IPLLLNFIASALLVCLV------------------GVQLTIA 305

  Fly   314 LSLGQIGSDLAFTTDSLSTMYYLTHWEQILQYSTNPSENL-------------RLLKLINLAIEM 365
            ||.......:.|....|..:|.|..:.|.|   .:.|||:             :..|.|.:.|.|
  Fly   306 LSPEYFCKQMLFLISVLLEVYLLCSFSQRL---IDASENVGHAAYDMDWLGSDKRFKKILIFISM 367

  Fly   366 NS-KPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTSM 402
            .| ||..:.......:|:......|..|:.:|..:.:|
  Fly   368 RSQKPVCLKATVVLDLSMPTMSIFLGMSYKFFCAVRTM 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 58/287 (20%)
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 58/287 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472806
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.