DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or63a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:449 Identity:93/449 - (20%)
Similarity:159/449 - (35%) Gaps:114/449 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VFRLNHI--FWPLDPS-TGKWGRYLDKVLAVAMSLVFMQHNDAELRYLR-----FEASNRNLDAF 78
            :.||::.  |..|||| .|:..|....||:|:.......|.....||:.     .|.:...|. |
  Fly    21 MIRLSYTVGFNLLDPSRCGQVLRIWTIVLSVSSLASLYGHWQMLARYIHDIPRIGETAGTALQ-F 84

  Fly    79 LTGMPT--YLILVEAQFRSL------HILLH----FEKLQKFLEIFYANIYIDPRKEPEMFRKVD 131
            ||.:..  |.:....|...|      |.||.    ||::.....|            .|:.::|:
  Fly    85 LTSIAKMWYFLFAHRQIYELLRKARCHELLQKCELFERMSDLPVI------------KEIRQQVE 137

  Fly   132 GKMIINRL-VSAMYGAVISLYLIAPVFS-------IINQSKDFL-----YSMIFPFDSDPLYIFV 183
            ..|  ||. .|.....:|.||....:.:       :||..:.|.     |.::.|..|       
  Fly   138 STM--NRYWASTRRQILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPS------- 193

  Fly   184 PLLLTNVWVGIVID-----TMMFGETNLLCEL------IVHLNGSYML-------LKRDLQLAIE 230
               |...|....::     ..|:.||   |.|      .|..:|.:::       |.|.|...:|
  Fly   194 ---LYPAWEHKGLEFPYYHIQMYLET---CSLYICGMCAVSFDGVFIVLCLHSVGLMRSLNQMVE 252

  Fly   231 KI---LVARDRPHMAKQLKVLITKTLRKNVALNQFGQQLE---AQYTVRVFIMFAFAAGL-LCAL 288
            :.   ||..||  ..:.|:..|.:..|    :..|..::.   ...|...|::..|..|| |..:
  Fly   253 QATSELVPPDR--RVEYLRCCIYQYQR----VANFATEVNNCFRHITFTQFLLSLFNWGLALFQM 311

  Fly   289 SFKAYTNPMANYIYAIWFGAKTVELLSLG-QI------GSDLAFTTDSLSTMYYLTHWEQILQYS 346
            |.....|.....|      ..|:.|::.| ||      |...|..::.::..:|...|.      
  Fly   312 SVGLGNNSSITMI------RMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWY------ 364

  Fly   347 TNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTSMQRR 405
               .|:.....||.:.:...::.|.:....:.::||...:.:::.|..||..|.::.::
  Fly   365 ---GESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQNVNQK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 73/375 (19%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 74/380 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465367
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.