DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or59c

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster


Alignment Length:411 Identity:71/411 - (17%)
Similarity:151/411 - (36%) Gaps:93/411 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WPLAVFRLNHIFWPLDPSTGKWGRYLDKVLAVAMSLVFMQHNDAELRYLRFEASNRNLDAFLTGM 82
            |.|....|..::.||                 .:||.:::|.|      ||..:.     |||.:
  Fly    51 WTLTTMWLGIVYLPL-----------------GLSLTYVKHFD------RFTPTE-----FLTSL 87

  Fly    83 PTYLILVEAQFRSLHILLHFEKLQKFLEIFYANIYIDPRKEPEMFRKVDGKMI--INRLVSAMYG 145
            ...:..:....:|........:.::..|:..:   :|.|......|::..||:  :|.:|...  
  Fly    88 QVDINCIGNVIKSCVTYSQMWRFRRMNELISS---LDKRCVTTTQRRIFHKMVARVNLIVILF-- 147

  Fly   146 AVISLYLIAPVFSIINQSKDFLYSMIFPFDSDPLYIFVPLL-----LTNVWVGIVID-------T 198
              :|.||   .|..:.     |::.:|. ...|..::.||:     ...:|:..:::       |
  Fly   148 --LSTYL---GFCFLT-----LFTSVFA-GKAPWQLYNPLVDWRKGHWQLWIASILEYCVVSIGT 201

  Fly   199 MMFGETNLLCELIVHLNGSYMLLKRDLQLAIEKILVARDRPHMA-----KQLKVLITKTLRKNVA 258
            |....::....:.:.|...::.:.||      :|...|..|.::     :|:...|    :.:..
  Fly   202 MQELMSDTYAIVFISLFRCHLAILRD------RIANLRQDPKLSEMEHYEQMVACI----QDHRT 256

  Fly   259 LNQFGQQLEAQYTVRVFIMFAFAAGL---LCALSFKAYTNP----MANYIYAIWFGAKTVELLSL 316
            :.|..|.:....::.:|..| ...|:   |.|:|...:.|.    |||..:.:   |...|....
  Fly   257 IIQCSQIIRPILSITIFAQF-MLVGIDLGLAAISILFFPNTIWTIMANVSFIV---AICTESFPC 317

  Fly   317 GQIGSDLAFTTDSLSTMYYLTHWEQILQYSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVS 381
            ..:...|...:..:|...:.::|     .:.:.|....:|..::.|    .:|...|....|.:|
  Fly   318 CMLCEHLIEDSVHVSNALFHSNW-----ITADRSYKSAVLYFLHRA----QQPIQFTAGSIFPIS 373

  Fly   382 LQAGLKILQASFSYFTFLTSM 402
            :|:.:.:.:.:|:..|.:..|
  Fly   374 VQSNIAVAKFAFTIITIVNQM 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 57/344 (17%)
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 57/349 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465971
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.