DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or56a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:404 Identity:76/404 - (18%)
Similarity:144/404 - (35%) Gaps:134/404 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DKVLAVAMSLVFMQHNDAELRYLRFEASNRNLDAFLTGMPTYLILVEAQFRSLHILLHFEKLQKF 108
            |||:    ||:.:.|:|  ::.|..||.||.::        .|:..:|..|::.:|:....:...
  Fly   100 DKVI----SLLRVAHSD--IQNLMHEADNREME--------LLVATQAYTRTITLLIWIPSVIAG 150

  Fly   109 LEIFYANIYIDPRKEPEMFRKVDGKMIINRLVSAMYGAVISLYLIAPVFSI--INQSKD--FLYS 169
            |..:...||                              .||:|...||::  :.:.::  .|..
  Fly   151 LMAYSDCIY------------------------------RSLFLPKSVFNVPAVRRGEEHPILLF 185

  Fly   170 MIFPFDS----------DPLYIFVPLLLTNVWVGIVIDTMMFGETNLLCELIVHLNGSYMLLKR- 223
            .:|||..          .|.|.          :|:.|..:....|.:.| |:.::|....:|.: 
  Fly   186 QLFPFGELCDNFVVGYLGPWYA----------LGLGITAIPLWHTFITC-LMKYVNLKLQILNKR 239

  Fly   224 ----DLQLAIEKILVARDRPHMAKQLKV----LITKTLRKNVALNQFGQQLEAQYTVRVFIMFAF 280
                |:.....|:::.|   ..|.:|..    |..:.:::.:.:.:|.|:|:....|.|...|..
  Fly   240 VEEMDITRLNSKLVIGR---LTASELTFWQMQLFKEFVKEQLRIRKFVQELQYLICVPVMADFII 301

  Fly   281 AAGLLCALSFK---------------AYTNPMANYIYAI-WFGAKTVELLSLGQIGSDLAFTTDS 329
            .:.|:|.|.|.               .|...||..::.. |.....||             ..|.
  Fly   302 FSVLICFLFFALTVGVPSKMDYFFMFIYLFVMAGILWIYHWHATLIVE-------------CHDE 353

  Fly   330 LSTMYYLTHW-------EQILQYSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLK 387
            ||..|:...|       :::|.:....::  |.:|:..|.:::|.:.|               :.
  Fly   354 LSLAYFSCGWYNFEMPLQKMLVFMMMHAQ--RPMKMRALLVDLNLRTF---------------ID 401

  Fly   388 ILQASFSYFTFLTS 401
            |.:.::|||..|.|
  Fly   402 IGRGAYSYFNLLRS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 59/364 (16%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 59/362 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.