DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or49a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:438 Identity:72/438 - (16%)
Similarity:165/438 - (37%) Gaps:118/438 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VFRLNHIF----WPLDPSTGKWGRYLDKVLAVAMSLV-----------FMQHNDAELRYLRFEAS 71
            :|..|.:|    :.|..:...|.|||         ||           |.:.:....|.:.:|: 
  Fly    11 IFMANMMFKTLGYDLFHTPKPWWRYL---------LVRGYFVLCTISNFYEASMVTTRIIEWES- 65

  Fly    72 NRNLDAFLTGMPT--------YLILVEAQFRSLHILLHFEKLQKFLEIFYANIYIDPRKEPEMFR 128
                   |.|.|:        :..::.:|.:.:..:::.::|   |::.:....:.|.||....:
  Fly    66 -------LAGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRL---LQLSHRLKELYPHKEQNQRK 120

  Fly   129 KVDGKMIIN---RLVSAMYGAVISLYLIAP-----VFSIINQSK-DFLYSMIFP----FDSD-PL 179
            ....|..::   |.|..:|..|:.:..:.|     :..:|...| ||.|..|||    |||: ||
  Fly   121 YEVNKYYLSCSTRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPL 185

  Fly   180 YIFVPLLLTNVWVGIVIDTMMFGETNLLC---ELIVHLNGSYMLLKRDLQLAIEKILVARDRPHM 241
            ...:..::...:...:::..:..:..::|   ::.:||  .|:         ...:...|..|..
  Fly   186 GYVLAYVIDFTYSQFIVNVSLGTDLWMMCVSSQISMHL--GYL---------ANMLASIRPSPET 239

  Fly   242 AKQLKVLITKTLRKNVALNQFGQQLEAQYTVRVFI---MFAFAAGLLCALSFKAYTNPMANYIYA 303
            .:|....:...::::..:.:.  |.:..|...:.:   :|..:. |||.:::           |.
  Fly   240 EQQDCDFLASIIKRHQLMIRL--QKDVNYVFGLLLASNLFTTSC-LLCCMAY-----------YT 290

  Fly   304 I-----WFGAKTVELLSLGQIGSDLAFTTDSLSTMYYL--THWEQILQYSTNPSE---------- 351
            :     |.|...:.|.:             |::..:|:  :|.:.::..|||.::          
  Fly   291 VVEGFNWEGISYMMLFA-------------SVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEG 342

  Fly   352 NLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFL 399
            :||..|.|.:.:....:|..::......:||.....::..::.:|..:
  Fly   343 SLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFAVI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 58/363 (16%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 54/336 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472811
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.