DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or47b

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster


Alignment Length:456 Identity:86/456 - (18%)
Similarity:143/456 - (31%) Gaps:167/456 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KLAWPLAVFRLNHIFWPLDPSTGKWGRYL-------------DKVLAVAMSLVFMQHNDAELR-- 64
            ||| .|.::|..::|...:..|..|..::             |.|....|:|||.:.....||  
  Fly    54 KLA-SLPLYRWINLFIMCNVMTIFWTMFVALPESKNVIEMGDDLVWISGMALVFTKIFYMHLRCD 117

  Fly    65 ----------YLRFEASNRNLDAFLTGMPTYLILVEAQFRSLHI----LLHFEKLQKFLEIFYAN 115
                      |...|....|:|..:.|......::|:   .|:|    |::|         |.|.
  Fly   118 EIDELISDFEYYNRELRPHNIDEEVLGWQRLCYVIES---GLYINCFCLVNF---------FSAA 170

  Fly   116 IYIDPRKEPEMFRKVDGKMIINRLVSAMYGAVISLYLIAPVFSIINQSKDFLYSMIFPF-----D 175
            |::.|                                      ::.:.| ..:..::||     |
  Fly   171 IFLQP--------------------------------------LLGEGK-LPFHSVYPFQWHRLD 196

  Fly   176 SDPLYIFVPLLLTNVWVGIVIDTMMFGETNLLCELIVHLNGSYMLLKRDLQLAI----------- 229
            ..| |.|..|.   :|..:.      .:.||:..|:|.:.|....|:..|.|.:           
  Fly   197 LHP-YTFWFLY---IWQSLT------SQHNLMSILMVDMVGISTFLQTALNLKLLCIEIRKLGDM 251

  Fly   230 ---------EKILVARDRPHMAKQLKVLITKTLRKNVALN-QFGQQLEAQY---TVRVFIMFAFA 281
                     |...|.|...|:.|    |:.|.   |.|.| .|..||.|.:   ::..|...|.|
  Fly   252 EVSDKRFHEEFCRVVRFHQHIIK----LVGKA---NRAFNGAFNAQLMASFSLISISTFETMAAA 309

  Fly   282 AGLLCALSFKAYTNPMANYIYAIWFGAKTVEL-------LSLGQIGSDLAFT--TDSLSTMYYLT 337
            |           .:|.        ..||.|.|       |||..:...|.:|  .:.....:.:.
  Fly   310 A-----------VDPK--------MAAKFVLLMLVAFIQLSLWCVSGTLVYTQSVEVAQAAFDIN 355

  Fly   338 HWEQILQYSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTSM 402
            .|     ::.:|.    :.:.|:..|....||.......:...:|...:.:|:   :.:..|..|
  Fly   356 DW-----HTKSPG----IQRDISFVILRAQKPLMYVAEPFLPFTLGTYMLVLK---NCYRLLALM 408

  Fly   403 Q 403
            |
  Fly   409 Q 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 65/360 (18%)
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 75/412 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465432
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.