DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or47a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_523689.1 Gene:Or47a / 36187 FlyBaseID:FBgn0026386 Length:385 Species:Drosophila melanogaster


Alignment Length:374 Identity:68/374 - (18%)
Similarity:134/374 - (35%) Gaps:90/374 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RNLDAFLTGMPTYLILVEAQFRSLHILLHFEKLQKFLEIF-------------YANIYIDPRKEP 124
            :|:......|...||.:...|:...||......::.::.|             ||.|.....|:.
  Fly    55 KNVLLLADAMVALLITILGLFKFSMILYLRRDFKRLIDKFRLLMSNEAEQGEEYAEILNAANKQD 119

  Fly   125 E----MFRKVDGKMIINRLVSAMYGAVISLYLIAPVFSIINQSKDFL-YSMIFPFDSDPLYIFVP 184
            :    :||..       .|::....:|:.|..:...:.:...::..| :..:||::   ::|...
  Fly   120 QRMCTLFRTC-------FLLAWALNSVLPLVRMGLSYWLAGHAEPELPFPCLFPWN---IHIIRN 174

  Fly   185 LLLTNVW-----VGIV-----IDTMMFGETNLLCELIVHLNGSYMLLKRDLQLAIEKILVARDRP 239
            .:|:.:|     .|:|     :||:....|:.||..                ..|.:..|.|.:.
  Fly   175 YVLSFIWSAFASTGVVLPAVSLDTIFCSFTSNLCAF----------------FKIAQYKVVRFKG 223

  Fly   240 HMAKQLKVLITKTLRKNVALNQFG----QQLEAQYTVRVFIMFAFAAGLLCALSFKAYTNPMANY 300
            ...|:.:.    ||.|..||.|..    ..|...|...:...|..::..||          |..|
  Fly   224 GSLKESQA----TLNKVFALYQTSLDMCNDLNQCYQPIICAQFFISSLQLC----------MLGY 274

  Fly   301 IYAIWFGAKT-------------VELLSLGQIGSDLAFTTDSLSTMYYLTHWEQILQYSTNPSEN 352
            :::|.| |:|             ::.......|.:|...:.|.....|.:.|.:.|...   ..:
  Fly   275 LFSITF-AQTEGVYYASFIATIIIQAYIYCYCGENLKTESASFEWAIYDSPWHESLGAG---GAS 335

  Fly   353 LRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTS 401
            ..:.:.:.:::....:.|.:||. :|..:::|...|::.:.||.|.|.|
  Fly   336 TSICRSLLISMMRAHRGFRITGY-FFEANMEAFSSIVRTAMSYITMLRS 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 63/363 (17%)
Or47aNP_523689.1 7tm_6 56..375 CDD:251636 63/363 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465676
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.