DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or43a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster


Alignment Length:447 Identity:86/447 - (19%)
Similarity:165/447 - (36%) Gaps:144/447 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GQKVKLAWPLAVFRLNHIFWPLDPSTG-KWGRYLDKVLAVAMSLVFMQHNDAELRYLRFEASNRN 74
            |..|::...|||         |.|:.| .|.::...:...||:|         ::::.......:
  Fly    10 GINVRMWRHLAV---------LYPTPGSSWRKFAFVLPVTAMNL---------MQFVYLLRMWGD 56

  Fly    75 LDAFLTGMPTYLILVEAQFRSLHILLHFEKLQKFL----EIFYANIYIDPRKE------PEMFRK 129
            |.||:..|..:..:..|..|:..:::...:.::||    .:|::  .:|...|      ....|:
  Fly    57 LPAFILNMFFFSAIFNALMRTWLVIIKRRQFEEFLGQLATLFHS--ILDSTDEWGRGILRRAERE 119

  Fly   130 VDGKMIINRLVSAMYGAVISLYLIAPVFSIINQSKDFLYSMIFP---FDSDPLYIFV-------P 184
            .....|:|  :||.:..::.. |::|:|   .:.:...:.:..|   ..|.|:|..:       |
  Fly   120 ARNLAILN--LSASFLDIVGA-LVSPLF---REERAHPFGLALPGVSMTSSPVYEVIYLAQLPTP 178

  Fly   185 LLLTNVW---VGIVIDTMMFGETNLLCELIVHLNGSYMLLKRDLQLAIEKILVARDRPHMAKQLK 246
            |||:.::   |.:.....:||:..|  :::||..|         |:..|:    :......::|.
  Fly   179 LLLSMMYMPFVSLFAGLAIFGKAML--QILVHRLG---------QIGGEE----QSEEERFQRLA 228

  Fly   247 VLI---TKTLRKNVALNQFGQQLEAQYTVRVFIMFAFAAGLLCALSF--KAYTNPMANYIYAIWF 306
            ..|   |:.:|....||    :|.|.......|:|   ..::|:|.|  ...|:|          
  Fly   229 SCIAYHTQVMRYVWQLN----KLVANIVAVEAIIF---GSIICSLLFCLNIITSP---------- 276

  Fly   307 GAKTVELLSLGQIGSDLAFTTDSLSTMYYLTHWEQILQYSTNPSENLRLLKLINLAIEMN----- 366
                .:::|:               .||.||....:..|....:|         :.:|.|     
  Fly   277 ----TQVISI---------------VMYILTMLYVLFTYYNRANE---------ICLENNRVAEA 313

  Fly   367 --SKPFYVTGLKY------FRVSLQAGLKI----------------LQASFSYFTFL 399
              :.|:|..|.::      |.:..|..::|                |.||:||||.|
  Fly   314 VYNVPWYEAGTRFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMFQSLLNASYSYFTML 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 68/375 (18%)
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 68/375 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466134
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.