DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or42b

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:240 Identity:45/240 - (18%)
Similarity:82/240 - (34%) Gaps:88/240 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LAVFRLNHIF-------------------------WPLDPSTGKWGRYLD-----KVLAVAMSLV 54
            |.|.|.||.|                         |.|      :..::|     ..|.||.:|.
  Fly   132 LVVARSNHAFLIFTFVYCGYAGSTYLSSVLSGRPPWQL------YNPFIDWHDGTLKLWVASTLE 190

  Fly    55 FMQHNDAELRYLRFEASNRNLDAFLTGMP-TYLILVEAQFRSLHILLHFEKLQKFLEIFYANIYI 118
            :|..:.|.|:           |......| .|.:::.|         |.:.|::.:....::..:
  Fly   191 YMVMSGAVLQ-----------DQLSDSYPLIYTLILRA---------HLDMLRERIRRLRSDENL 235

  Fly   119 DPRKEPEMFRK--VDGKMIINRLVSAMYGAVISLYLIAPVFSIINQSKDFLYSMIFPFDSDPLYI 181
            ...:..|...|  :|.|:|:.      |.|:|...:...:|     ::..|..::..|....::.
  Fly   236 SEAESYEELVKCVMDHKLILR------YCAIIKPVIQGTIF-----TQFLLIGLVLGFTLINVFF 289

  Fly   182 FVPLLLTNVWVG---------IVIDTMMFGET-NLL---CELIVH 213
            |     :::|.|         |::.|..|..| ||:   ||.:.|
  Fly   290 F-----SDIWTGIASFMFVITILLQTFPFCYTCNLIMEDCESLTH 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 29/156 (19%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 45/240 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465958
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.