DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or33a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster


Alignment Length:383 Identity:80/383 - (20%)
Similarity:148/383 - (38%) Gaps:98/383 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LDAFLTGM-PTYLIL-------VEAQFRSLHI-----------------LLHFEKLQKFLEIFYA 114
            :.:|:|.: |.:|||       ::. |||||.                 |...:.::..|:    
  Fly    39 ITSFITILFPVHLILGMYKKPQIQV-FRSLHFTSECLFCSYKFFCFRWKLKEIKTIEGLLQ---- 98

  Fly   115 NIYIDPRKEPEMFRKV--DGKMIINRLVSAMY-GAVISLYLIAPVFSIINQSKDFLYSMIFPFD- 175
              .:|.|.|.|..|..  .....:.|::|..| .|.||..:.|.|..:.:..::.:|...||:| 
  Fly    99 --DLDSRVESEEERNYFNQNPSRVARMLSKSYLVAAISAIITATVAGLFSTGRNLMYLGWFPYDF 161

  Fly   176 --SDPLYIFVPLLLTNVWVGIVIDTMMFGETNLLCELIVHLNGSY----------------MLLK 222
              :..:|          |:......:  |.:.|:.|.:.  |.||                |.|.
  Fly   162 QATAAIY----------WISFSYQAI--GSSLLILENLA--NDSYPPITFCVVSGHVRLLIMRLS 212

  Fly   223 R---DLQLAIE---KILVARDRPHMAKQLKVLITKTLRKNVALNQFGQQLEAQYTVRV-FIMFAF 280
            |   |::|:..   :.|:...:.| .|.:|::  :.||..:.|:|.||.|.:...:.: .|...|
  Fly   213 RIGHDVKLSSSENTRKLIEGIQDH-RKLMKII--RLLRSTLHLSQLGQFLSSGINISITLINILF 274

  Fly   281 AAGLLCALSFKAYTNPMANYIYAIWFGAKTVELLSLGQIGSDLAFTTDSLSTMYYLTHWEQILQY 345
            .|           .|..|...||::|.|..:||......|..:....|.|....:.::|   |:.
  Fly   275 FA-----------ENNFAMLYYAVFFAAMLIELFPSCYYGILMTMEFDKLPYAIFSSNW---LKM 325

  Fly   346 STNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTSMQ 403
            ....:.:|.:|..:.| :.:|.|...:.|     :.:.|....::.::|::|...|.:
  Fly   326 DKRYNRSLIILMQLTL-VPVNIKAGGIVG-----IDMSAFFATVRMAYSFYTLALSFR 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 77/371 (21%)
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 71/349 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465854
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.