DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or24a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:259 Identity:50/259 - (19%)
Similarity:103/259 - (39%) Gaps:44/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 KDFLY----SMIFPFDSD-----PLYIFVPLLLTNVWVGIVIDTMMFGETNLLCELIVHLNGSYM 219
            ||::|    .|:||   |     |||....:|:.  |.|.:......|.........::.....:
  Fly   163 KDWIYETPFKMMFP---DLLLRLPLYPITYILVH--WHGYITVVCFVGADGFFLGFCLYFTVLLL 222

  Fly   220 LLKRDL--QLAIEKILVARDRPHMAKQLKVL--ITKTLRKNVALNQFGQQLE---AQYTVRVFIM 277
            .|:.|:  .|.:|.|   ...|..|::.:::  :.|.:.::..:.:..::|.   .:.|:..|:.
  Fly   223 CLQDDVCDLLEVENI---EKSPSEAEEARIVREMEKLVDRHNEVAELTERLSGVMVEITLAHFVT 284

  Fly   278 FAFAAG--LLCALSFKAYTNPMANYIYAIWFGAKTVE--LLSLGQIGSDLAFTTDSLSTMYYLTH 338
            .:...|  ::..|.|..    :...:|.::..|..||  |..||  ||.:.....:|:...:.:|
  Fly   285 SSLIIGTSVVDILLFSG----LGIIVYVVYTCAVGVEIFLYCLG--GSHIMEACSNLARSTFSSH 343

  Fly   339 WEQILQYSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTSM 402
            |.         ..::|:.|:..|.:....:...:. :.:|..||:....||:.:.|......|:
  Fly   344 WY---------GHSVRVQKMTLLMVARAQRVLTIK-IPFFSPSLETLTSILRFTGSLIALAKSV 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 48/248 (19%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 48/248 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.