DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or23a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_523458.3 Gene:Or23a / 33450 FlyBaseID:FBgn0026395 Length:379 Species:Drosophila melanogaster


Alignment Length:367 Identity:71/367 - (19%)
Similarity:136/367 - (37%) Gaps:83/367 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LTGMPTYLIL---------VEAQF------RSLHILLHF----EKLQKFLEIFYANIYIDPR--- 121
            |..:||.::|         ||..|      .||..|:.|    .:|.|.:|:......:|.|   
  Fly    42 LVYLPTPMLLRGVYSFEDPVENNFSLSLTVTSLSNLMKFCMYVAQLTKMVEVQSLIGQLDARVSG 106

  Fly   122 -KEPEMFRKVDGKMI-INRLVSAMYGAVISLYLIAPVFSIINQSKDFLYSMIFPFD-SDPLYIFV 183
             .:.|..|.:...:: :::|....|..|   ::||.|..:..........|.|||| .:.:..::
  Fly   107 ESQSERHRNMTEHLLRMSKLFQITYAVV---FIIAAVPFVFETELSLPMPMWFPFDWKNSMVAYI 168

  Fly   184 PLLLTNVWVGIVIDTMM-FGETNL----------LCELIV----HLNGSYMLLKRDLQLAIEKIL 233
            ..|:... :|.|...|. |...:.          .|:|::    .:...|..|:.:.|..:..| 
  Fly   169 GALVFQE-IGYVFQIMQCFAADSFPPLVLYLISEQCQLLILRISEIGYGYKTLEENEQDLVNCI- 231

  Fly   234 VARDRPHMAKQLKVLITKTLRKNVALNQFGQQLEAQYTVRVFIMFAFAAGLLCALSFKAYTNPMA 298
              ||:..:.:.|.|  ||:|.....:.|| ..:.....:.:|::.             .|...:.
  Fly   232 --RDQNALYRLLDV--TKSLVSYPMMVQF-MVIGINIAITLFVLI-------------FYVETLY 278

  Fly   299 NYIYAIWF--GAKTVELLSLGQIGSDLAFTTDSLSTMYYLTHWEQILQYSTNPSENLRLL----K 357
            :.||.:.|  |. ||:...|...|:   ...:|.:.::|.......:..|.:...::.:|    |
  Fly   279 DRIYYLCFLLGI-TVQTYPLCYYGT---MVQESFAELHYAVFCSNWVDQSASYRGHMLILAERTK 339

  Fly   358 LINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFL 399
            .:.|.:..|..|          :.|...:...:.::|:||.:
  Fly   340 RMQLLLAGNLVP----------IHLSTYVACWKGAYSFFTLM 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 68/359 (19%)
Or23aNP_523458.3 7tm_6 59..365 CDD:251636 64/342 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465828
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.