DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or22b

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster


Alignment Length:427 Identity:77/427 - (18%)
Similarity:159/427 - (37%) Gaps:118/427 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LNHIFWPLD---PSTGKWGRY-----------LDKVLAVAMSLVFMQHNDAELRYLRFEASNRNL 75
            |:.:.|...   |...:|..:           :..:|.:::|:.::|      |:..|.|..   
  Fly    27 LDRVMWSFGWTVPENKRWDLHYKLWSTFVTLLIFILLPISVSVEYIQ------RFKTFSAGE--- 82

  Fly    76 DAFLTGMPTYLILVEAQFRSLHILLHFEKLQKFLEIFYANIYIDPRKEPEMFRKV---DGKMIIN 137
              ||:.:...:.:..:.|:|...::.::|.|:      |.:.:|     |:.::.   :.:.|::
  Fly    83 --FLSSIQIGVNMYGSSFKSYLTMMGYKKRQE------AKMSLD-----ELDKRCVCDEERTIVH 134

  Fly   138 RLVS------AMYGAVISLYLIAPVFSIINQSKDFLYSMIFPFDSDP---LYI--FVPLLLTN-- 189
            |.|:      ..|....:.:||:...|.| ..:...:.|.||: .||   .||  ...::|..  
  Fly   135 RHVALGNFCYIFYHIAYTSFLISNFLSFI-MKRIHAWRMYFPY-VDPEKQFYISSIAEVILRGWA 197

  Fly   190 VWVGIVIDTMMFGETNLLCELIVHLNGSYMLLKRDLQLAIEKILVARDRPHMAKQ--LKVLITKT 252
            |::.:..|         :|.||     |.::.:..:.|..:::...|..|...:.  ||.| ...
  Fly   198 VFMDLCTD---------VCPLI-----SMVIARCHITLLKQRLRNLRSEPGRTEDEYLKEL-ADC 247

  Fly   253 LRKNVALNQFGQQLEAQYTVRVFIMFAFAAGLLCALS------FKAYTNPMANYIYAIWFGAKTV 311
            :|.:..:..:...|.:.::..:|:.| ...|::..||      |...:..:|..::......:|.
  Fly   248 VRDHRLILDYVDALRSVFSGTIFVQF-LLIGIVLGLSMINIMFFSTLSTGVAVVLFMSCVSMQTF 311

  Fly   312 ELLSL-GQIGSDLAFTTDSL-------------STMYYLTHWEQILQYSTNPSENLRLLKLINLA 362
            ....| ..|..|.....|||             ||:.|..|             ||:        
  Fly   312 PFCYLCNMIMDDCQEMADSLFQSDWTSADRRYKSTLVYFLH-------------NLQ-------- 355

  Fly   363 IEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFL 399
                 :|..:|....|.:|:|..|.:::.:|:..|.:
  Fly   356 -----QPIILTAGGVFPISMQTNLNMVKLAFTVVTIV 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 65/356 (18%)
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 65/359 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466023
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.