DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and AgaP_AGAP005495

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_556129.1 Gene:AgaP_AGAP005495 / 3289983 VectorBaseID:AGAP005495 Length:416 Species:Anopheles gambiae


Alignment Length:432 Identity:81/432 - (18%)
Similarity:155/432 - (35%) Gaps:97/432 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FW--PLDPSTGKW-GRYLDK----VLAVAMSLVFMQHNDAELRYLRFEASNRNLDAFLTGMPTYL 86
            :|  .|..:.|.| |:|:..    ...|...::.|...:..|:...|..:..||...:.|:.:::
Mosquito    21 YWVRALATTMGIWPGQYVSMRSHWYRRVYYFMLLMHWLNTFLQTEFFFRNLGNLGLVVQGLCSFV 85

  Fly    87 ILVEAQFRSLHILLHFEKLQKFLEIFYANIYIDPRKEPEMFRKVDGKMIINRL------------ 139
            .:.....:.:.|..:..::.:..:......:|   |:....||.|...|..|:            
Mosquito    86 SITTTGIKVMRIHAYEAEIVQLWQTLQDATFI---KKIRFLRKTDRGTIFQRIHQLLARQCKEVQ 147

  Fly   140 -----VSAMYGAVISLYLIAPVFS-IINQ------SKDFLYSMIFPF-----DSDPLY--IFVPL 185
                 .:.:.|.|.|.|.|.|..| :.||      ::.|:|:..:|.     ...||:  :|...
Mosquito   148 LNLRFYTLVVGLVASNYSIIPACSNLYNQFQGNAFNRSFVYNTYYPLLEPIKRRSPLFELLFCSE 212

  Fly   186 LLT--NVWVGIVIDTMMFGETNLLCELIVHLNGSYMLLKRD-LQLAIEKILVARDRPHMAKQLKV 247
            .|:  ..|.|:|      ....|...::::. .|.|.|.|| |.......|...:|....::..:
Mosquito   213 SLSGYTTWAGVV------AFDGLYVAMVLYA-ASLMRLLRDLLHETANPGLTDAERAFFQRECIL 270

  Fly   248 LITKTLRKNVALNQFGQQLEAQYTVRVFIMFAFAAGLLCALSFKA---------YTNPMANYIYA 303
            ...:|::....:|:.       ::..:.:....:..::|.::|.|         .|..|..|:.|
Mosquito   271 HHIRTIQLIEKINEI-------FSPVLLVQLFTSTSIICVIAFAASMHADEGDSQTMLMVLYLIA 328

  Fly   304 --------IWFGAKTVELLSLGQIGSDLAFTTDSLSTMYYLTHWEQILQYSTNPSENLRLLKLIN 360
                    .|:|.:      |...|::|..:.       |...||...|...:....|.|..  .
Mosquito   329 AIYQLFQFCWYGQR------LQNEGTELPRSV-------YDAQWELCAQRFKSTQHVLLLYS--Q 378

  Fly   361 LAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTSM 402
            ..|||.:..|....|:.|..       |::::.||||.|.::
Mosquito   379 RQIEMRAWSFSAMSLETFST-------IIRSAVSYFTVLQTL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 66/369 (18%)
AgaP_AGAP005495XP_556129.1 7tm_6 73..404 CDD:251636 66/369 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.