DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or10a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:293 Identity:66/293 - (22%)
Similarity:107/293 - (36%) Gaps:84/293 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 LIAPVFSIINQSKDFL----YSMIFP-----FDSDPL-YIFVPLLLTNVWVGIVIDTMMFGETNL 206
            |||.:..:.|:.:||:    ::|..|     :...|| |||:      .:.|.|...|..|....
  Fly   157 LIAMILYLQNRYEDFVWFTPFNMTMPKVLLNYPFFPLTYIFI------AYTGYVTIFMFGGCDGF 215

  Fly   207 LCELIVHLNGSYMLLKRDLQLAIEKILVARDRPH------MAKQLKVLITK----TLRKN--VAL 259
            ..|...||:..:.:    ||..||.:.    ||:      ...||.:|..|    .:|.|  :.|
  Fly   216 YFEFCAHLSALFEV----LQAEIESMF----RPYTDHLELSPVQLYILEQKMRSVIIRHNAIIDL 272

  Fly   260 NQFGQQLEAQYTVRVFIMFAFAAGLLCALSFKAYTNPMANYIYAIWFGAKTVELLSLGQIGSD-- 322
            .:|   ...:||:.....|..||.::                     |...|.||:||..|..  
  Fly   273 TRF---FRDRYTIITLAHFVSAAMVI---------------------GFSMVNLLTLGNNGLGAM 313

  Fly   323 --LAFTTDSLSTMYYLTHWEQILQYST---------------NPSENLRLLKLINLAIEMNSKPF 370
              :|:|..:||.:....:...::..|:               .|.:.    :|:.|.|..:.:|.
  Fly   314 LYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQR----RLVQLLILRSQRPV 374

  Fly   371 YVTGLKYFRVSLQAGLKILQASFSYFTFLTSMQ 403
            .: .:.:|..||.....|||.|.|....:.|.|
  Fly   375 SM-AVPFFSPSLATFAAILQTSGSIIALVKSFQ 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 62/281 (22%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 62/281 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465328
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.