DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or9a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:392 Identity:72/392 - (18%)
Similarity:146/392 - (37%) Gaps:99/392 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ASNRNLDAFLTGMPTYLILVE--------------------AQFRSLHILLHF----EKLQKFLE 110
            |::|....|:|..|.:|.:|.                    :.|.|:..|:.|    ...::|:.
  Fly    37 ANDRPWLTFVTMGPLFLFMVPMFLAAHEYITQVSLLSDTLGSTFASMLTLVKFLLFCYHRKEFVG 101

  Fly   111 IFY---------ANIYIDPRKEPEMFRKVDGKMIINRLVSAMYGAVISLYLIAPVFSIINQS--- 163
            :.|         ..::.|.|:..|:..:.|  .:::...:..:|.......:.|...||..|   
  Fly   102 LIYHIRAILAKEIEVWPDAREIIEVENQSD--QMLSLTYTRCFGLAGIFAALKPFVGIILSSIRG 164

  Fly   164 ----KDFLYSMIFPFDSDPLYIFVPLLLTNVW-------VGIVIDTMMFGETNLLCEL------- 210
                .:..::.::|:|...:..:||..|.||.       :.:.:|:::|..|..:|.:       
  Fly   165 DEIHLELPHNGVYPYDLQVVMFYVPTYLWNVMASYSAVTMALCVDSLLFFFTYNVCAIFKIAKHR 229

  Fly   211 IVHL---NGSYMLLKRDLQLAIEKILVARDRPHMAKQLKVLITKTLRKNVALNQFGQQLEAQYTV 272
            ::||   .|     |.:|:..::.:|              |..|.|       |....:..:|..
  Fly   230 MIHLPAVGG-----KEELEGLVQVLL--------------LHQKGL-------QIADHIADKYRP 268

  Fly   273 RVFIMFAFAAGLLCALSFKA---YTNPMANYIYAIWFGAKTVELLSLGQIGSDLAFTTDSLSTMY 334
            .:|:.|..:|..:|.:.|:.   :.||.:.|..| :.|:..:.|....:.|.::...:.......
  Fly   269 LIFLQFFLSALQICFIGFQVADLFPNPQSLYFIA-FVGSLLIALFIYSKCGENIKSASLDFGNGL 332

  Fly   335 YLTHWEQILQYSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFL 399
            |.|:|...     :|.....||    :|.....:|..:.|. :|..|:.....|::::.||...|
  Fly   333 YETNWTDF-----SPPTKRALL----IAAMRAQRPCQMKGY-FFEASMATFSTIVRSAVSYIMML 387

  Fly   400 TS 401
            .|
  Fly   388 RS 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 66/378 (17%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 61/351 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465689
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.