DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or82a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:384 Identity:71/384 - (18%)
Similarity:136/384 - (35%) Gaps:66/384 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SLVFMQHNDAELRYLRFEASNRN--------LDAFLTGMPTYLIL------------VEAQFRSL 96
            ||:|:  ..|:...:.:.|.|||        |....|.|.|.:.:            :..:||.:
  Fly    36 SLIFV--ISAQYPLISYVAYNRNDMEKVTACLSVVFTNMLTVIKISTFLANRKDFWEMIHRFRKM 98

  Fly    97 H--ILLHFEKLQKFLEIFYANIYIDPRKEPEMFRKVDGKMIINRLVSAMYGAVISLYLIAPVFSI 159
            |  ...|..:.::.|:      |:....:...|        :.|......|.....:::.|:..|
  Fly    99 HEQSASHIPRYREGLD------YVAEANKLASF--------LGRAYCVSCGLTGLYFMLGPIVKI 149

  Fly   160 -------INQSKDFLYSMIFPFDSDPLYIFVPLLLTNVWVGIVIDTMMFGETNLLCELIVHLNGS 217
                   ....|:....|.|||:......:....|..|.|.:|:.........|.....::|...
  Fly   150 GVCRWHGTTCDKELPMPMKFPFNDLESPGYEVCFLYTVLVTVVVVAYASAVDGLFISFAINLRAH 214

  Fly   218 YMLLKRDLQLAIEKILVARDRPHMAKQLKVLITKTLRKNVALNQFGQQLEAQYTVRVFIMFAFAA 282
            :..|:|.    ||........|....:||.::    ..:|.|....::|.:.||..|...|...:
  Fly   215 FQTLQRQ----IENWEFPSSEPDTQIRLKSIV----EYHVLLLSLSRKLRSIYTPTVMGQFVITS 271

  Fly   283 GLLCALSFKAYTN---PMANYIYAIWFGAKTVELLSLGQIGSDLAFTTDSLSTMYYLTHWEQILQ 344
            ..:..:.::..||   .|...:||.:||:..::|......|..:...:..:.|...|::|     
  Fly   272 LQVGVIIYQLVTNMDSVMDLLLYASFFGSIMLQLFIYCYGGEIIKAESLQVDTAVRLSNW----- 331

  Fly   345 YSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTSMQ 403
            :..:|.....|..:|     :.|:...:....:|..||...:.|.:.:.|..|.:.|::
  Fly   332 HLASPKTRTSLSLII-----LQSQKEVLIRAGFFVASLANFVGICRTALSLITLIKSIE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 61/350 (17%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 60/340 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.