DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or65c

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster


Alignment Length:311 Identity:60/311 - (19%)
Similarity:105/311 - (33%) Gaps:96/311 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GQKVKLAWPLA--------VFRLNHIFWPLDPSTGKWGRYLDKVL-AVAMSLVFMQHNDAELRYL 66
            |.||::...:|        .|::.:..|        :|..||:|: |:.....:.|.....:.|.
  Fly    84 GDKVQMGRDIAFIIGFFYIAFKIYYFQW--------YGDELDEVVEALETFHPWAQKGPGAVDYR 140

  Fly    67 RFEASNRNLDAFLTG-----MPTYLIL-------VEAQFRSLHILLHFEKLQKFLE-IFYANIYI 118
            ..:.....|..||..     :..:::|       |..|...||....|:..:|.:. |.:|.|| 
  Fly   141 TAKRWYFTLAFFLASSWLVFLCIFILLLITSPLWVHQQILPLHAAFPFQWHEKSIHPISHAFIY- 204

  Fly   119 DPRKEPEMFRKVDGKMIINRLVSAMYGAVISLYL-IAPVFSIINQSKDFLYSMIFPFDSDPLYIF 182
                   :|:..:....:..|| .:.|..:|:|: |.....::......|:.....::...|   
  Fly   205 -------LFQTWNVMYFLTWLV-CIEGLSVSIYVEITFAIEVLCLELRHLHQRCHGYEQLRL--- 258

  Fly   183 VPLLLTNVWVGIVIDTMMFGETNLLCEL---IVHL--------NGSYMLLKRDLQLAIEKILV-- 234
                                |||.|.:.   |||:        :|:.:     :|:.:...||  
  Fly   259 --------------------ETNRLVQFHQKIVHILDHTNKVFHGTLI-----MQMGVNFFLVSL 298

  Fly   235 -------ARDRPHMAKQLKVLITKTLRKNVALNQFGQQL--------EAQY 270
                   ||..|.:..|..||:...|......:.||..|        ||.|
  Fly   299 SVLEAMEARKDPKVVAQFAVLMLLALGHLSMWSYFGDLLSQKSLTISEAAY 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 47/239 (20%)
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 58/308 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465393
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.