DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or65a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_729161.1 Gene:Or65a / 318011 FlyBaseID:FBgn0041625 Length:417 Species:Drosophila melanogaster


Alignment Length:474 Identity:94/474 - (19%)
Similarity:148/474 - (31%) Gaps:192/474 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RYVPRFADGQ---KVKLAWPLAVFRLNHIFWPLDPSTG---KWGR---YLDKVLAVAMSLVFMQH 58
            |.:||....|   .::||..||     .:|:.:..|.|   ..||   ::..::.:...|||...
  Fly    58 RRLPRIVAWQYFVSIQLATALA-----SLFYGISESIGDIVNLGRDLVFIITIIFICFRLVFFAQ 117

  Fly    59 NDAELRYLRFEASNRNLDA------------------------FLTGMP------TYLIL----- 88
            ...||..:        :||                        ||..|.      ::|||     
  Fly   118 YAGELDVI--------IDALEDIYHWSIKGPATKEVQETKRLHFLLFMALIITWFSFLILFMLIK 174

  Fly    89 ------VEAQFRSLHILLHFEKLQKFLEIFYANIYIDPRKEPEMFRKVDGKMIINRLVSAMYGAV 147
                  :|:|....|:...|:             ..||.|.|                       
  Fly   175 ISTPFWIESQTLPFHVSWPFQ-------------LHDPSKHP----------------------- 203

  Fly   148 ISLYLIAPVFSIINQSKDFLYSMIFPFDSDPLYIFVPLLLTNVWVGIVID---TMMFGETNLLCE 209
                 ||.:...::||...||.:|                   |:|:|.:   ::.|..|:.|..
  Fly   204 -----IAYIIIFVSQSTTMLYFLI-------------------WLGVVENMGVSLFFELTSALRV 244

  Fly   210 LIVHLNGSYMLLKRDLQ---LAIEKILVARDRPHMAKQLKVLITKTLRKNVALNQFGQQLEAQYT 271
            |.:.|        |:||   |..|.:|. |:...|.|..:.:|..|.|.|...|           
  Fly   245 LCIEL--------RNLQELCLGDEDMLY-RELCRMTKFHQQIILLTDRCNHIFN----------- 289

  Fly   272 VRVFIMFAFAAGLLCALS----FKAYTNPMANYIYAIWFGAKTVELLSLGQIGSDLAFTTDSLST 332
             ..|||......||.:||    ..|..||.....|.|      :.|::||               
  Fly   290 -GAFIMQMLINFLLVSLSLFEVLAAKKNPQVAVEYMI------IMLMTLG--------------- 332

  Fly   333 MYYLTHWEQILQYSTNPSENLRLL-----------KLIN----LAIEMNSKPFYVTGLKYFRVSL 382
              :|:.|.:.....:..||.:.|.           |.|:    ..|:...||..:....:...:|
  Fly   333 --HLSFWSKFGDMFSKESEQVALAVYEAYDPNVGSKSIHRQFCFFIQRAQKPLIMKASPFPPFNL 395

  Fly   383 QAGLKILQASFSYFTFLTS 401
            :..:.||:..:|..|.|.:
  Fly   396 ENYMFILKQCYSILTILAN 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 73/384 (19%)
Or65aNP_729161.1 7tm_6 145..406 CDD:251636 71/364 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.