DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or2a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:345 Identity:57/345 - (16%)
Similarity:139/345 - (40%) Gaps:64/345 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ILVEAQFRSLHIL---LHFEKLQKFLEIFYANIYI--DPRKEPEMFRKVDGKMIINRLVSAMYGA 146
            |:...:|.:::::   ||  :::..|.:..|...:  ||.:...:.::|:       :....:..
  Fly    81 IVANLKFANVYMVRKQLH--EIRSLLRLMDARARLVGDPEEISALRKEVN-------IAQGTFRT 136

  Fly   147 VISLYLIAPVFS----IINQSKDFLYSMIFPFD---SDPLYIFVPLLLTNVW--VGIVIDTMMFG 202
            ..|:::.....|    ::...::.||...|..|   |...|:     |.|::  .|:::..:...
  Fly   137 FASIFVFGTTLSCVRVVVRPDRELLYPAWFGVDWMHSTRNYV-----LINIYQLFGLIVQAIQNC 196

  Fly   203 ETN-----LLCELIVHLNGSYMLLKRDLQLAIEKILVARDRPHMAKQLKVL-------ITKTLRK 255
            .::     .||.|..|:        |.|:|.:.:|....::.:..:..:..       :.:.:|.
  Fly   197 ASDSYPPAFLCLLTGHM--------RALELRVRRIGCRTEKSNKGQTYEAWREEVYQELIECIRD 253

  Fly   256 NVALNQFGQQLEAQYTVRVFIMFAFAAGLLCALSFK-AYT----NPMANYIYAIWFGAKTVELLS 315
            ...:::..:.::...:|.....|..:|.:.|.::.. .|.    :..|..|..::|.|.|:|:..
  Fly   254 LARVHRLREIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLEVFV 318

  Fly   316 LGQIGSDLAFTTDSLSTMYYLTHW-EQILQYSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFR 379
            :...|..:...:::|...:|..:| ||:      |.....||    ..:....:|..:....|..
  Fly   319 ICYFGDRMRTQSEALCDAFYDCNWIEQL------PKFKRELL----FTLARTQRPSLIYAGNYIA 373

  Fly   380 VSLQAGLKILQASFSYFTFL 399
            :||:...::::.::|.||.|
  Fly   374 LSLETFEQVMRFTYSVFTLL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 53/337 (16%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 53/337 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465906
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.