DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or1a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster


Alignment Length:308 Identity:62/308 - (20%)
Similarity:108/308 - (35%) Gaps:90/308 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 RLVSAMY-----GAVISLYLIAPVFSII--NQSKDFL----YSMIFPFD-SDP--------LYIF 182
            :|::|:|     |..:|..|:....:::  :.:.:|.    :.::.|:| :.|        |.:|
  Fly   125 QLMAAIYFMMCAGTSVSFLLMPVALTMLKYHSTGEFAPVSSFRVLLPYDVTQPHVYAMDCCLMVF 189

  Fly   183 VPLLLTNVWVGIVIDTMMFGETNLLCELIVHLNGSYMLLKRDLQ------------LAIEKILVA 235
            |.........|  :|| ::|    .|.|.|.|  .|..|.:.|:            ..:..|.|.
  Fly   190 VLSFFCCSTTG--VDT-LYG----WCALGVSL--QYRRLGQQLKRIPSCFNPSRSDFGLSGIFVE 245

  Fly   236 RDRPHMAKQLKVLITKTLRKNVALNQFGQQLEAQYTVRVFIMFAFAAGLLCALSFKAYTNPMANY 300
            .     |:.||::               |.....:....|:......||.|::..: |..|..|.
  Fly   246 H-----ARLLKIV---------------QHFNYSFMEIAFVEVVIICGLYCSVICQ-YIMPHTNQ 289

  Fly   301 IYAIWFGAKTVELLSLGQIGSDLAFTTDSLSTMYYLTHWEQI---------LQYSTNPSENL--R 354
            .:|.           ||..  .|..||   ....||...||:         |.|...|.:||  :
  Fly   290 NFAF-----------LGFF--SLVVTT---QLCIYLFGAEQVRLEAERFSRLLYEVIPWQNLPPK 338

  Fly   355 LLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTSM 402
            ..||....||...:. .|.|..:|.:.....:.|.:.:.|:.|.:.::
  Fly   339 HRKLFLFPIERAQRE-TVLGAYFFELGRPLLVWIFRTAGSFTTLMNAL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 60/297 (20%)
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 60/297 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465728
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.