DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or69a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:404 Identity:90/404 - (22%)
Similarity:148/404 - (36%) Gaps:106/404 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AMSLVFMQHNDAELRYLRFEASNRNLD--------AFLTGMPTYLILVEAQ-FRSLHILLHFEK- 104
            |::||:  ||...:.|..| ...|..|        |.:..|..:.|:.... ::.|.:..|||. 
  Fly    46 AVNLVY--HNIGCVMYGYF-GDGRTKDPIAYLAELASVASMLGFTIVGTLNLWKMLSLKTHFENL 107

  Fly   105 LQKFLEIFYA---NIYIDPRKEPEMFRKVDGKMIINRLVSAMYGAVISLYLIAPVFSIINQSKDF 166
            |.:|.|:|..   ..|.....:.:..|.:....|.:......|.::..|.:|...||...|    
  Fly   108 LNEFEELFQLIKHRAYRIHHYQEKYTRHIRNTFIFHTSAVVYYNSLPILLMIREHFSNSQQ---- 168

  Fly   167 LYSMIFPFDSDPLY----------IFVPLLL------TNVWVGIVIDTMM--FGETNLLCELIVH 213
               :.:...|:..|          .|..:..      ||:.|.:.|..::  ||     .:|.:|
  Fly   169 ---LGYRIQSNTWYPWQVQGSIPGFFAAVACQIFSCQTNMCVNMFIQFLINFFG-----IQLEIH 225

  Fly   214 LNGSYMLLKRDLQLAIEKILVARDRPHMAKQLKVLI---TKTL----RKNVALNQFGQQLEAQYT 271
            .:|    |.|.|:     .:.||: ||...|||.||   ||.|    |.|.:.|           
  Fly   226 FDG----LARQLE-----TIDARN-PHAKDQLKYLIVYHTKLLNLADRVNRSFN----------- 269

  Fly   272 VRVFIMFAFAAGLLCALSFKAYTNPMANYIYAIW-FGAKTVELL----------SLGQIGSDLAF 325
                  |.|    |.:||....:|....:...:: ||.....||          |:.:.|:.|..
  Fly   270 ------FTF----LISLSVSMISNCFLAFSMTMFDFGTSLKHLLGLLLFITYNFSMCRSGTHLIL 324

  Fly   326 TTDS-LSTMYYLTHWEQILQYSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKIL 389
            |:.. |...:|...:|..|.|.       |:|.::.:..   :||:.....|...||:...:..|
  Fly   325 TSGKVLPAAFYNNWYEGDLVYR-------RMLLILMMRA---TKPYMWKTYKLAPVSITTYMATL 379

  Fly   390 QASFSYFTFLTSMQ 403
            :.|:..||.:.|::
  Fly   380 KFSYQMFTCVRSLK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 78/368 (21%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 77/361 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472814
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.