DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and GPROR33

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_001688726.1 Gene:GPROR33 / 1276429 VectorBaseID:AGAP005760 Length:451 Species:Anopheles gambiae


Alignment Length:198 Identity:38/198 - (19%)
Similarity:68/198 - (34%) Gaps:57/198 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 AIEKILVARDRPHMAKQLKVLITKTLRKNVALNQFGQQLEAQYTVRVFIMFAFAAGLLCALSFK- 291
            |:..:.:.:.|..:|     |.:...|..:....|..:|:..|...:...|..:..::|..:|: 
Mosquito   286 AVAVVSIGKTRMSLA-----LFSTPERPLLFTGSFCNRLKRLYEPNIMAQFVCSMLIICLTAFEL 345

  Fly   292 --AYTNPMANYIYAIWFGAKTVELLSLGQIGSDLAFTTDSLSTMYYLTHWEQILQYS------TN 348
              |..:||    ..:.|||                         |.|..:.|:..:|      ||
Mosquito   346 MFAKGDPM----QMVRFGA-------------------------YMLAGFYQVFVWSFFGNRVTN 381

  Fly   349 PSENLR--------------LLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFL 399
            .|..:.              |.|.:......:.|||.:.....|.::.:..:.||..|:|.||.|
Mosquito   382 MSTGISDATISCNWIVLADGLKKDLRFTTMRSQKPFVIDVYWLFPLTYETFIAILSRSYSIFTLL 446

  Fly   400 TSM 402
            .:|
Mosquito   447 RTM 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 32/187 (17%)
GPROR33XP_001688726.1 7tm_6 <315..440 CDD:251636 27/153 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21137
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.