DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and GPROR32

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_315048.1 Gene:GPROR32 / 1275762 VectorBaseID:AGAP004951 Length:384 Species:Anopheles gambiae


Alignment Length:409 Identity:93/409 - (22%)
Similarity:156/409 - (38%) Gaps:110/409 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ELRYLRF-----EASNRN----LDAF-------------LTGMPTYLILVEAQFRSLHILLHFEK 104
            :.|.:||     :.|.||    |.||             |...|...::|..: ..:.|.|.|..
Mosquito    11 QFRLIRFCGVVEQPSLRNNVRCLFAFILLCSFGPLHVWYLAKTPVLDLVVTCE-EIMLIQLCFVM 74

  Fly   105 LQKFLEIFYANIYIDPRKEPEMFRKVDG-KMIINRLVSAMY---------------------GAV 147
            |.||      |::|..|.  .|:..|:. |.|:..:..|.:                     ..|
Mosquito    75 LLKF------NLFITYRS--GMYNLVEAFKRILKCIDKAEFARFVKCSELHAKLLRAYVIGTSIV 131

  Fly   148 ISLY----LIAPVFSIINQSK-DFLYSMIFPFDSDPLYIFV-------PLLLTNVWVGIVIDTMM 200
            :.||    ::|.:...:.|:| .|:....||||.....:|.       ..:|..|...:.:|: .
Mosquito   132 LLLYELNAIVASITLSLQQNKVCFVTPFSFPFDYQHPIVFALTFLHNFDAMLVTVCTSVTVDS-C 195

  Fly   201 FGETNLLCELIVHLNGSYMLLKRDLQLAIEKILVARDRPHMAKQLKVLITKTLRKNVALNQFGQQ 265
            |.|  :...|.:|.:     :.|:   ..||:.::..:|:...||:.:||.. |:.::|.|...|
Mosquito   196 FSE--MASNLTIHFD-----IVRE---RFEKLDLSAAQPYAEHQLRNVITYH-REVLSLAQKMVQ 249

  Fly   266 LEAQYTVRVFIMFAFAAGLLCALSFKAYTNPMANYIYAIWFGAKTVELLSLGQI----------- 319
            |   |....|.:....:.:||.|   .|...|.:.||      |.:::..|..|           
Mosquito   250 L---YQQSAFYLLLLVSTILCLL---GYEFVMVSNIY------KRMQVAILASIMIGQAAIYTYH 302

  Fly   320 GSDLAFTTDSLSTMYYLTHWEQILQYSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQA 384
            ||.::..:.|::...|.|:|     |..    .|.:.||:.:.:....||..:.. .:...||..
Mosquito   303 GSAISAKSVSVADAIYGTNW-----YDA----PLAVKKLVYICLMRAQKPVIMKS-GFIEASLPT 357

  Fly   385 GLKILQASFSYFTFLTSMQ 403
            ..|||.:|.||.|.|.|::
Mosquito   358 LKKILSSSASYITMLMSLE 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 82/380 (22%)
GPROR32XP_315048.1 7tm_6 71..365 CDD:251636 73/335 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21137
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.