DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and GPROR43

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_314477.1 Gene:GPROR43 / 1275234 VectorBaseID:AGAP010504 Length:386 Species:Anopheles gambiae


Alignment Length:382 Identity:83/382 - (21%)
Similarity:144/382 - (37%) Gaps:110/382 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRYVPRF------ADGQKVKLAWPLAVFRLN----------HIFWPLDPSTGKWGRYLDKVL-A 48
            ::|:...|      |...|..:...||.|.|:          ..|||:          |||:: :
Mosquito    16 LIRWFASFVGLDIMAPNYKPNILTFLAFFGLSISLIGEVYTVWYFWPI----------LDKLMES 70

  Fly    49 VAMSLVFMQ---HNDAELRYLR-FEASNRNLDAFLTGMPTYLILVEAQFRSLHILLHFEKLQKFL 109
            .|:..||:|   .....|||.: |||....||.|                      |:|      
Mosquito    71 AAIFGVFIQGLAKFYIALRYRKFFEAMYNRLDLF----------------------HYE------ 107

  Fly   110 EIFYANIYIDPRKEPEMFRKVDGKMIINRLVSAMYGAVISLYLIAPVFSIINQSKDFL-YSMIFP 173
               |.|   ..:....:...::...::.:|:::.:...|...::.||...|.:.:.|| |::|.|
Mosquito   108 ---YRN---HEKNNATLLLLMNRICLLRKLITSQFSISILTLMVTPVAQYILKGERFLVYTIILP 166

  Fly   174 FDSDP---------LYIFVPLLLTNV-------WVGIVIDTMMFGETNLLCELIVHLNGSYMLLK 222
            | :||         |.:...||:..:       .|.|:..|.:.|..::|...|..:|    .|.
Mosquito   167 F-TDPEITSHYLLNLVVQYYLLIVGLAGFSAAESVLILFVTSVAGYADVLKNKINEMN----TLL 226

  Fly   223 RDLQLAIEKILVARDRPHMAKQLKVLITKTLRKNVALNQ----FGQQLEAQYTVRVFIMFAFAAG 283
            .|.|       .:|||..:  :||      ||:.|.|:|    :...|:.:|.:..::..|.:..
Mosquito   227 LDAQ-------NSRDRTSV--KLK------LREIVLLHQRVLEYEDDLDKRYYLNNWVQVASSIF 276

  Fly   284 LLCALSFKAY-TNPMANYIYAIWFGAKTVELLSLGQIGSDLAFTTDSLSTMYYLTHW 339
            .|....|..| :|....|..||..   .::|..|..:|:.|:...:.:...:|.:.|
Mosquito   277 NLTGALFGCYVSNSFTMYALAITI---VIQLFELCLLGTILSIKNEEIEHAFYDSLW 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 59/288 (20%)
GPROR43XP_314477.1 7tm_6 67..375 CDD:251636 69/321 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.