DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and GPROR57

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_313640.1 Gene:GPROR57 / 1274505 VectorBaseID:AGAP004357 Length:400 Species:Anopheles gambiae


Alignment Length:429 Identity:81/429 - (18%)
Similarity:166/429 - (38%) Gaps:102/429 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GQKVKLAWPLAVFRLNHIFWPLDPSTGKWGRYLDKVLAVAMSLVFMQHNDAELRYLRFEASNRNL 75
            ||::. ::.|.|..:..:.| |.||   |           :.||..|.|     ..||..:...|
Mosquito    31 GQRIP-SFGLLVTAIYPLIW-LIPS---W-----------LFLVSSQDN-----ITRFMKAANEL 74

  Fly    76 DAFLTGMPTYLILVEAQFRSLHILLHFEKLQKFLEIFYANIYIDPRKEPEMFRKVDGKMIINRLV 140
            ..|      .||..:..|.::| ...:|||...|:..::::..:|..|.:.......|...|  :
Mosquito    75 IVF------SLIFCKLCFYAIH-FRRWEKLFYDLQRSFSSVLNNPSLEIQTILGHVTKSTHN--L 130

  Fly   141 SAMYGAVISL----YLIAPVFSIINQSKDFLYSMIFPFD---SDPL--YIFVPLLLTNVWVGIVI 196
            :..|.:.:|.    |.:.|:..|:.:     |::...:|   |.|:  ..|:|.|.||.||.:.:
Mosquito   131 TKYYCSTVSFNCAAYGLFPMLFIVVK-----YAVTGSYDVPLSTPIEANYFIPGLRTNFWVWLPV 190

  Fly   197 DTMMFGETNLLCELIVHLNGSYML---------------LKRDLQLAIEKILVARDRPHMAKQLK 246
                    |:....::.|:|..:.               |.|.||:.      |.:..|..:..|
Mosquito   191 --------NITLSAMLELHGFALFFVETFTWNLVYATSCLFRILQIQ------ANELSHQCRNEK 241

  Fly   247 VLITKTLRKNVALN----QFGQQLEAQYTVRVFIMFAFAAGLLC----ALSFKAYTNPMANYIYA 303
            ....| |:..:||:    :..:.||...::::.:::......||    .||.      ..|.:|.
Mosquito   242 EWNGK-LKTFIALHDSVLRSAETLEEILSLQMLLLYLSTILALCLGMVVLSL------AVNEVYV 299

  Fly   304 IW-----FGAKTVELLSLGQIGSDLAFTTDSLSTMYYLTHWEQILQYSTNPSENLRLLKLINLAI 363
            :.     ||....:..|...:|::|...:::::...:.:.|.         ::.|...|.:...:
Mosquito   300 LLTTMAVFGYCIFQTFSFSYLGTELIEQSEAVADAIFHSKWY---------TQKLNRQKDMCFLM 355

  Fly   364 EMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTSM 402
            ....:|..:|..|.|.|:..:..::::.:::.|..::.:
Mosquito   356 MRAKRPVKLTAAKLFVVTRDSFTQVIKQAYTIFALMSQV 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 65/355 (18%)
GPROR57XP_313640.1 7tm_6 83..385 CDD:251636 61/339 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.