| Sequence 1: | NP_609759.1 | Gene: | CG11865 / 34917 | FlyBaseID: | FBgn0028947 | Length: | 240 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_112613.1 | Gene: | Bmp1 / 83470 | RGDID: | 620739 | Length: | 990 | Species: | Rattus norvegicus |
| Alignment Length: | 200 | Identity: | 68/200 - (34%) |
|---|---|---|---|
| Similarity: | 97/200 - (48%) | Gaps: | 8/200 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 46 RVVKSWSEYYWKGRTLVYSYAGGFSSLDIASIESAMAEISSKTCVKF-RRTEYKREPQVVIQKEG 109
Fly 110 SGCWSYVGYLGRADQTLNLGSGCMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEH 174
Fly 175 NFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKN-GQSTIVPLKS----HAKIGQATQMSPKDVQT 234
Fly 235 LKRMY 239 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG11865 | NP_609759.1 | Astacin | 56..239 | CDD:279708 | 64/188 (34%) |
| ZnMc_astacin_like | 58..239 | CDD:239807 | 63/186 (34%) | ||
| Bmp1 | NP_112613.1 | ZnMc_BMP1_TLD | 125..324 | CDD:239808 | 66/198 (33%) |
| Astacin | 132..325 | CDD:279708 | 64/191 (34%) | ||
| CUB | 326..435 | CDD:278839 | |||
| CUB | 439..548 | CDD:278839 | |||
| FXa_inhibition | 559..591 | CDD:291342 | |||
| CUB | 595..704 | CDD:278839 | |||
| FXa_inhibition | 711..746 | CDD:291342 | |||
| CUB | 751..860 | CDD:278839 | |||
| CUB | 864..977 | CDD:278839 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||