Sequence 1: | NP_609759.1 | Gene: | CG11865 / 34917 | FlyBaseID: | FBgn0028947 | Length: | 240 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_112613.1 | Gene: | Bmp1 / 83470 | RGDID: | 620739 | Length: | 990 | Species: | Rattus norvegicus |
Alignment Length: | 200 | Identity: | 68/200 - (34%) |
---|---|---|---|
Similarity: | 97/200 - (48%) | Gaps: | 8/200 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 RVVKSWSEYYWKGRTLVYSYAGGFSSLDIASIESAMAEISSKTCVKF-RRTEYKREPQVVIQKEG 109
Fly 110 SGCWSYVGYLGRADQTLNLGSGCMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEH 174
Fly 175 NFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKN-GQSTIVPLKS----HAKIGQATQMSPKDVQT 234
Fly 235 LKRMY 239 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11865 | NP_609759.1 | Astacin | 56..239 | CDD:279708 | 64/188 (34%) |
ZnMc_astacin_like | 58..239 | CDD:239807 | 63/186 (34%) | ||
Bmp1 | NP_112613.1 | ZnMc_BMP1_TLD | 125..324 | CDD:239808 | 66/198 (33%) |
Astacin | 132..325 | CDD:279708 | 64/191 (34%) | ||
CUB | 326..435 | CDD:278839 | |||
CUB | 439..548 | CDD:278839 | |||
FXa_inhibition | 559..591 | CDD:291342 | |||
CUB | 595..704 | CDD:278839 | |||
FXa_inhibition | 711..746 | CDD:291342 | |||
CUB | 751..860 | CDD:278839 | |||
CUB | 864..977 | CDD:278839 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |