DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and LOC797085

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001373298.1 Gene:LOC797085 / 797085 -ID:- Length:285 Species:Danio rerio


Alignment Length:220 Identity:85/220 - (38%)
Similarity:112/220 - (50%) Gaps:26/220 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LQEDDIILISEQLQYFEGNLEGRVVKSWSEYYWKGR----TLVYSYAGGFSSLDIASIESAMAEI 84
            |:|:|||   .|.....||           :.|..:    ::.||.|.|... ....|.:|:..:
Zfish    84 LEEEDII---PQTDRNAGN-----------HLWPEKDGEVSVPYSIASGLED-KTGHILAALKMV 133

  Fly    85 SSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRADQTLNLGSGCMSNRTIQHELLHALGFF 149
            |.||||||.  .:..|...:..|....|.|.||..| .:|.:.:|..|.:. .|.||:||:||.:
Zfish   134 SKKTCVKFH--HHTTEEDYLHFKPDRMCASLVGCAG-GEQPILVGPKCNAG-NICHEILHSLGLY 194

  Fly   150 HTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKNGQSTIVP 214
            |.||.|.||||:.|..|||..|.|.||:..:.|   ..|..||.|||:|||...||:||..||:|
Zfish   195 HEHSRPDRDKYITILYDNIMPGKESNFKVKKGN---TLGLEYDLDSILHYGDDCFSRNGNHTIIP 256

  Fly   215 LKSHAKIGQATQMSPKDVQTLKRMY 239
            .|...||||.|.||..||:.|:|:|
Zfish   257 KKKGVKIGQRTHMSVLDVERLRRLY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 76/186 (41%)
ZnMc_astacin_like 58..239 CDD:239807 75/184 (41%)
LOC797085NP_001373298.1 ZnMc_astacin_like 111..281 CDD:239807 75/177 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H114254
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.