DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and c6ast1

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001036784.1 Gene:c6ast1 / 751088 ZFINID:ZDB-GENE-070621-1 Length:260 Species:Danio rerio


Alignment Length:190 Identity:74/190 - (38%)
Similarity:106/190 - (55%) Gaps:23/190 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EYYWKGRTLVYSYAGGFSSLDIASIESAMAEISSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVG 117
            ||..:.:.:::.   ||.||:            ..|||:||....:|:  .:..:..|||:|:||
Zfish    89 EYSTQEKDVIFQ---GFRSLE------------KSTCVRFRPRTTQRD--YINIEPNSGCYSFVG 136

  Fly   118 YLGRADQTLNLG-SGCMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRA 181
             .....||::|. .||:....:||||||.|||.|.|:...||.:|:|...||..|.|.||.:::.
Zfish   137 -RRTGGQTVSLDHDGCIKLNIVQHELLHTLGFHHEHNRSDRDSHVQIVYKNIIPGQERNFDKIKT 200

  Fly   182 NGVTNYGFGYDYDSIMHYGPFAFSKNGQSTIVPL-KSHAKIGQATQMSPKDVQTLKRMYC 240
            |   |....|||.|:||||.||||||.::||||: .|...||:|.:||..|:..:.|:||
Zfish   201 N---NLETAYDYSSVMHYGRFAFSKNKEATIVPIPDSGVTIGRAKRMSSNDILRINRLYC 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 70/184 (38%)
ZnMc_astacin_like 58..239 CDD:239807 70/182 (38%)
c6ast1NP_001036784.1 Astacin 71..259 CDD:279708 74/190 (39%)
ZnMc_hatching_enzyme 77..257 CDD:239810 72/188 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.