DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and TNFAIP6

DIOPT Version :10

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_009046.2 Gene:TNFAIP6 / 7130 HGNCID:11898 Length:277 Species:Homo sapiens


Alignment Length:46 Identity:13/46 - (28%)
Similarity:21/46 - (45%) Gaps:3/46 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 DNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKNGQST 211
            |.|.:|:....:.|....||..||...|.::   .|.:.|..|::|
Human   217 DIISTGNVMTLKFLSDASVTAGGFQIKYVAM---DPVSKSSQGKNT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 ZnMc_astacin_like 58..239 CDD:239807 13/46 (28%)
TNFAIP6NP_009046.2 Link_domain_TSG_6_like 36..128 CDD:239592
CUB 135..244 CDD:395345 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.