DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and tnfaip6

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001035333.2 Gene:tnfaip6 / 678516 ZFINID:ZDB-GENE-060421-2654 Length:271 Species:Danio rerio


Alignment Length:274 Identity:55/274 - (20%)
Similarity:82/274 - (29%) Gaps:102/274 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ALAVIFGLGSSANGRPSIKLQEDDIILISEQLQYFEGNLEGRVVKSWSE-----YY--------- 55
            ||..:||:        .|.|:|      :|...|..|.|...:   |.|     |:         
Zfish    11 ALTAVFGV--------LIVLKE------TEAWGYKNGILHNSI---WLEQAAGVYHRESRKGRYQ 58

  Fly    56 --WKGRTLVYSYAGG----FSSLDIASIESAMAEISSKTC----VKFRRTEYKREPQVVIQKEGS 110
              :|....|.::.||    |..|:      |..:|....|    :...|..|.      |.|.||
Zfish    59 LTYKEAKAVCNFEGGTLATFDQLE------AARQIGFHVCAAGWLDKGRVGYP------IVKAGS 111

  Fly   111 GCWSYVGYLGRADQTLNLGSG--------------CMSNRTIQHELLHALGFFHTHSDPQRDKYV 161
            .|.  .|.:|..|....|...              |....|...::|.:.|:    .|..:|:.:
Zfish   112 NCG--FGKVGIIDYGYRLNKSERWDVYCYNPVAKECGGVHTDPEKVLVSPGY----PDEYQDEQI 170

  Fly   162 RIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKNGQSTIVPLKSHAKIGQATQ 226
            ......:|.||     |:|                :|:..|...::...    |..|.:|..   
Zfish   171 CYWHIRVRFGH-----RIR----------------LHFLDFDIEEDTDC----LSDHLEIYD--- 207

  Fly   227 MSPKDVQTLKRMYC 240
             |..||......||
Zfish   208 -SYDDVSGFVGRYC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 39/204 (19%)
ZnMc_astacin_like 58..239 CDD:239807 38/202 (19%)
tnfaip6NP_001035333.2 Link_domain_TSG_6_like 46..138 CDD:239592 21/105 (20%)
CUB 145..254 CDD:278839 21/109 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.