DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and CG34370

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001097404.2 Gene:CG34370 / 5740565 FlyBaseID:FBgn0085399 Length:952 Species:Drosophila melanogaster


Alignment Length:123 Identity:30/123 - (24%)
Similarity:40/123 - (32%) Gaps:34/123 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YYWKGRT--LVYSYAGGFSSLDIASIESAM---------------------AEISSKTCVKFRRT 95
            |:.||..  :|..|   |.|..|..|||.:                     |.|....|..|.|.
  Fly   415 YHIKGHVGEIVRLY---FPSFRINRIESPILKYEGDCGESLTIYDSDHADPARIIKTFCDTFSRP 476

  Fly    96 EYK-----REPQVVIQ---KEGSGCWSYVGYLGRADQTLNLGSGCMSNRTIQHELLHA 145
            ..|     ..|.:.:|   |.||...|.:.|....|...|...|.....|:..|:::|
  Fly   477 MEKVDFVSTSPSLYVQFDSKTGSYSGSSLYYWAHYDFFNNTRFGDPVPNTLCDEVMYA 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 29/121 (24%)
ZnMc_astacin_like 58..239 CDD:239807 28/119 (24%)
CG34370NP_001097404.2 CUB 88..195 CDD:238001
CUB 244..363 CDD:238001
CUB 407..509 CDD:238001 24/96 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444812
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.