DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and c6ast4

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001020351.1 Gene:c6ast4 / 574001 ZFINID:ZDB-GENE-050626-100 Length:265 Species:Danio rerio


Alignment Length:192 Identity:73/192 - (38%)
Similarity:117/192 - (60%) Gaps:10/192 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WSEYYWKGRTLV-YSYAGGFSSLDIASIESAMAEISSKTCVKFRRTEYKREPQVVIQKEGSGCWS 114
            |.:|. .|:..| |..|..:||.::..|:..:...:|.:|::|.|...:|: .:.|:.. |||:|
Zfish    79 WPKYS-DGKIYVPYVIANHYSSRELEIIQRGLDSFASVSCIRFFRRSNERD-YISIESR-SGCYS 140

  Fly   115 YVGYLGRADQTLNLG-SGCMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQR 178
            |||..|.. ||::|. |||:.:.|:||||||||||.|..:...||.::::..:||....::||.:
Zfish   141 YVGRQGNV-QTVSLARSGCLYHSTVQHELLHALGFNHEQTRSDRDNHIQVIWENILDDMKYNFNK 204

  Fly   179 LRANGVTNYGFGYDYDSIMHYGPFAFSKNGQSTIVPL-KSHAKIGQATQMSPKDVQTLKRMY 239
            :   ...|.|..|||.|:|.|..:||||||..|::|: .::|::|::||||..|:..|.|:|
Zfish   205 I---NTLNQGTPYDYKSVMQYERYAFSKNGYPTMIPIPNNNAELGKSTQMSQNDITRLNRLY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 70/185 (38%)
ZnMc_astacin_like 58..239 CDD:239807 70/183 (38%)
c6ast4NP_001020351.1 Astacin 78..265 CDD:279708 73/192 (38%)
ZnMc 84..265 CDD:294052 71/186 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.