Sequence 1: | NP_609759.1 | Gene: | CG11865 / 34917 | FlyBaseID: | FBgn0028947 | Length: | 240 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001035126.1 | Gene: | bmp1a / 572452 | ZFINID: | ZDB-GENE-060818-1 | Length: | 986 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 72/201 - (35%) |
---|---|---|---|
Similarity: | 98/201 - (48%) | Gaps: | 10/201 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 RVVKSWSEYYWKGRTLVYSYAGGFSSLDIASIESAMAEISSKTCVKF--RRTEYKREPQVVIQKE 108
Fly 109 GSGCWSYVGYLGRADQTLNLGSGCMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHE 173
Fly 174 HNFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKN-GQSTIVPLKS----HAKIGQATQMSPKDVQ 233
Fly 234 TLKRMY 239 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11865 | NP_609759.1 | Astacin | 56..239 | CDD:279708 | 68/189 (36%) |
ZnMc_astacin_like | 58..239 | CDD:239807 | 67/187 (36%) | ||
bmp1a | NP_001035126.1 | ZnMc_BMP1_TLD | 112..309 | CDD:239808 | 71/198 (36%) |
Astacin | 117..309 | CDD:279708 | 69/193 (36%) | ||
CUB | 311..420 | CDD:278839 | |||
CUB | 424..533 | CDD:278839 | |||
FXa_inhibition | 544..576 | CDD:291342 | |||
CUB | 580..699 | CDD:278839 | |||
FXa_inhibition | 706..741 | CDD:291342 | |||
CUB | 746..855 | CDD:278839 | |||
CUB | 859..972 | CDD:278839 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |