DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and bmp1a

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001035126.1 Gene:bmp1a / 572452 ZFINID:ZDB-GENE-060818-1 Length:986 Species:Danio rerio


Alignment Length:201 Identity:72/201 - (35%)
Similarity:98/201 - (48%) Gaps:10/201 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RVVKSWSEYYWKGRTLVYSYAGGFSSLDIASIESAMAEISSKTCVKF--RRTEYKREPQVVIQKE 108
            |...|..|..|....:.|..:|.||....|....||......|||.|  |.||   |..:|....
Zfish   109 RAATSRPERVWPEGVIPYVISGNFSGSQRAIFRQAMRHWEKHTCVTFIERTTE---ESYIVFTYR 170

  Fly   109 GSGCWSYVGYLGRADQTLNLGSGCMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHE 173
            ..||.||||..|...|.:::|..|.....:.|||.|.:||:|.|:.|.||::|.|..|||:.|.|
Zfish   171 PCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVSIIRDNIQPGQE 235

  Fly   174 HNFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKN-GQSTIVPLKS----HAKIGQATQMSPKDVQ 233
            :||.::....|.:.|..||:||||||....||:. ...||:|...    ...|||.|::|..|:.
Zfish   236 YNFLKMEPGEVDSLGEVYDFDSIMHYARNTFSRGIFLDTILPRYDVNGVRPPIGQRTRLSKGDIA 300

  Fly   234 TLKRMY 239
            ..:::|
Zfish   301 QARKLY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 68/189 (36%)
ZnMc_astacin_like 58..239 CDD:239807 67/187 (36%)
bmp1aNP_001035126.1 ZnMc_BMP1_TLD 112..309 CDD:239808 71/198 (36%)
Astacin 117..309 CDD:279708 69/193 (36%)
CUB 311..420 CDD:278839
CUB 424..533 CDD:278839
FXa_inhibition 544..576 CDD:291342
CUB 580..699 CDD:278839
FXa_inhibition 706..741 CDD:291342
CUB 746..855 CDD:278839
CUB 859..972 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.