DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and mep1a.1

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001025452.1 Gene:mep1a.1 / 553530 ZFINID:ZDB-GENE-041001-209 Length:598 Species:Danio rerio


Alignment Length:229 Identity:83/229 - (36%)
Similarity:120/229 - (52%) Gaps:23/229 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EDD-----IILISEQLQYFEGNL---EGRVVKSWSEYYWKGRTLVYSYAGGFSSLDI---ASIES 79
            ||:     .|.:..:.:..||::   .||:....:.|.|| ..:.|..:   .|||:   .:|..
Zfish    29 EDEPNFNPFINLGAKTRLIEGDIALPPGRIGLINTTYRWK-FPIPYILS---DSLDLNAKGAIYQ 89

  Fly    80 AMAEISSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRADQTLNLGSGCMSNRTIQHELLH 144
            |......|:||.|:  .|:.|...:..::|.||||:||. .:..|.|:||.||.....|:|||||
Zfish    90 AFEVYRLKSCVDFK--PYEGEKTYIKFEKGDGCWSFVGD-QQNGQVLSLGPGCDHKAVIEHELLH 151

  Fly   145 ALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKNGQ 209
            ||||:|..|...||.||:|..|.:..|.||||.:...:.||:....|||:|:|||.||||:|:..
Zfish   152 ALGFYHMQSRQDRDDYVKIWLDQVIEGLEHNFNKYDDSFVTDLNTPYDYESVMHYRPFAFNKDPS 216

  Fly   210 ----STIVPLKSHAKIGQATQMSPKDVQTLKRMY 239
                :|.:| :.:..|||....|..|:..|.|||
Zfish   217 IPTITTNIP-EFYKIIGQYLDFSEMDIVRLNRMY 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 73/189 (39%)
ZnMc_astacin_like 58..239 CDD:239807 71/187 (38%)
mep1a.1NP_001025452.1 ZnMc 26..251 CDD:294052 83/229 (36%)
Astacin 65..253 CDD:279708 76/193 (39%)
MAM 261..420 CDD:279023
MAM 261..419 CDD:99706
MATH 419..582 CDD:295307
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.