DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and c6ast3

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001013544.1 Gene:c6ast3 / 541399 ZFINID:ZDB-GENE-050320-99 Length:255 Species:Danio rerio


Alignment Length:259 Identity:85/259 - (32%)
Similarity:136/259 - (52%) Gaps:39/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LALAVIFGLGSSANGRP---SIK----------LQEDDIILISEQLQYFEGNLE-----GRVVKS 50
            |||..::    ||.|:|   |:.          :.|.|...:.:.:...|.|.:     |.:   
Zfish    11 LALMFVY----SAEGKPAQLSVSELLHRANRGIIPEADEPKLLDDIAVNEKNADPCTSYGCL--- 68

  Fly    51 WSEYYWKGRTLV-YSYAGGFSSLDIASIESAMAEISSKTCVKFRRTEYKR--EPQVVIQKEGSGC 112
            |.:|. .|:..| |..|..:||.::..|:..:...|..||::|    :.|  |...:..:..|||
Zfish    69 WPKYS-DGKIYVPYVIANHYSSRELEIIQRGLDSFSYSTCIRF----FPRGNERDYISIESRSGC 128

  Fly   113 WSYVGYLGRADQTLNLG-SGCMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNF 176
            :||||..|.| ||::|. |||:.:.|:||||||||||.|..:...||.::::..:||....::||
Zfish   129 YSYVGRQGYA-QTVSLARSGCLYHSTVQHELLHALGFNHEQTRNDRDNHIQVIWENILDDMKYNF 192

  Fly   177 QRLRANGVTNYGFGYDYDSIMHYGPFAFSKNGQSTIVPL-KSHAKIGQATQMSPKDVQTLKRMY 239
            .::   ...|.|..|||.|:|.|..:||||||..|::|: .::|.:|.:|:||..|:..:.|:|
Zfish   193 NKV---NTLNQGTPYDYSSVMQYERYAFSKNGLPTMIPIPNNNAALGTSTEMSQNDIIRINRLY 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 69/187 (37%)
ZnMc_astacin_like 58..239 CDD:239807 69/185 (37%)
c6ast3NP_001013544.1 Astacin 68..255 CDD:279708 72/198 (36%)
ZnMc 74..255 CDD:294052 70/188 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.