DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and ASTL

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_011509507.1 Gene:ASTL / 431705 HGNCID:31704 Length:436 Species:Homo sapiens


Alignment Length:250 Identity:71/250 - (28%)
Similarity:115/250 - (46%) Gaps:39/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GSSANGRPSIKLQEDDIILISEQLQYFEGNLEGRVVK-------SWSEYYWKGRTLVYSYAGGFS 70
            |:.|:|...|......:||  |:.......:||.:::       |.:...|.        .||..
Human    51 GTQASGDKDIPAINQGLIL--EETPESSFLIEGDIIRPSPFRLLSATSNKWP--------MGGSG 105

  Fly    71 SLDIASIES-------------AMAEISSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRA 122
            .:::..:.|             |:||....||::|...:.:|:...:|..  .||:|.||..| .
Human   106 VVEVPFLLSSKYDEPSRQVILEALAEFERSTCIRFVTYQDQRDFISIIPM--YGCFSSVGRSG-G 167

  Fly   123 DQTLNLGSGCM--SNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVT 185
            .|.::|...|:  ....:.|||:|.|||:|.|:...||:|:|:..:.|..|.|.||.:.:::.:.
Human   168 MQVVSLAPTCLQKGRGIVLHELMHVLGFWHEHTRADRDRYIRVNWNEILPGFEINFIKSQSSNML 232

  Fly   186 NYGFGYDYDSIMHYGPFAFSKNGQSTIVPL-KSHAKIGQATQMSPKDVQTLKRMY 239
            .   .|||.|:||||..|||:.|..||.|| .....|||...:|..|:..:.::|
Human   233 T---PYDYSSVMHYGRLAFSRRGLPTITPLWAPSVHIGQRWNLSASDITRVLKLY 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 60/198 (30%)
ZnMc_astacin_like 58..239 CDD:239807 59/196 (30%)
ASTLXP_011509507.1 Astacin 97..288 CDD:279708 60/201 (30%)
ZnMc 105..286 CDD:294052 57/185 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.