Sequence 1: | NP_609759.1 | Gene: | CG11865 / 34917 | FlyBaseID: | FBgn0028947 | Length: | 240 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287510.1 | Gene: | tok / 42944 | FlyBaseID: | FBgn0004885 | Length: | 1464 | Species: | Drosophila melanogaster |
Alignment Length: | 204 | Identity: | 69/204 - (33%) |
---|---|---|---|
Similarity: | 103/204 - (50%) | Gaps: | 14/204 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 RVVKSWSEYYWKGRTLVYSYAGGFSSLDIASIESAMAEISSKTCVKFRRTEYKREPQ-----VVI 105
Fly 106 QKEGSGCWSYVGYLGRADQTLNLGSGCMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRS 170
Fly 171 GHEHNFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKNGQ-STIVPL----KSHAKIGQATQMSPK 230
Fly 231 DVQTLKRMY 239 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11865 | NP_609759.1 | Astacin | 56..239 | CDD:279708 | 65/192 (34%) |
ZnMc_astacin_like | 58..239 | CDD:239807 | 64/190 (34%) | ||
tok | NP_001287510.1 | ZnMc_BMP1_TLD | 520..721 | CDD:239808 | 68/203 (33%) |
Astacin | 527..721 | CDD:279708 | 66/196 (34%) | ||
CUB | 723..836 | CDD:294042 | |||
CUB | 840..951 | CDD:278839 | |||
FXa_inhibition | 958..993 | CDD:291342 | |||
CUB | 997..1111 | CDD:278839 | |||
FXa_inhibition | 1118..1153 | CDD:291342 | |||
CUB | 1158..1267 | CDD:278839 | |||
CUB | 1271..1390 | CDD:238001 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45444809 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR10127 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.840 |