DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and CG6974

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster


Alignment Length:282 Identity:73/282 - (25%)
Similarity:113/282 - (40%) Gaps:81/282 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHYLALAVIFGLGSSANGRPSIKLQEDDIILISEQLQYFEGNLEGRVVKSWSEYY---------- 55
            :.||.||.||.        |::...|.                    ::|:..||          
  Fly     6 VRYLLLAGIFA--------PNLVASEG--------------------IESYENYYNEIHIDDEQA 42

  Fly    56 --------------WKGRTLVYSYAGGFSSLDIASIESAMAEISSKTCVKFRRTE---------- 96
                          |.|..::|..:..:|..::|::.:||:....:|||:|...|          
  Fly    43 EAKTRNALTSPLQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKRYV 107

  Fly    97 -YKREPQVVIQKEGSGCWSYVGY--LGRADQTLNLGSGCMS-NRTIQHELLHALGFFHTHSDPQR 157
             :|:.|.:        |.:.|||  |......:.|...|:: ...||||.||.||.||..|.|.|
  Fly   108 SFKKSPNM--------CGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDR 164

  Fly   158 DKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKN-GQSTIVPL----KS 217
            |:||:|..|||...:...|..:  :..|.:...|||:|:|||...||:|: .:.||..|    ..
  Fly   165 DEYVQIDYDNIPRKYWSQFMAM--DQTTTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAV 227

  Fly   218 HAKIGQATQMSPKDVQTLKRMY 239
            ..::||....|..|...::.||
  Fly   228 EREMGQVRGPSEGDWTKIRLMY 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 60/201 (30%)
ZnMc_astacin_like 58..239 CDD:239807 59/199 (30%)
CG6974NP_650414.1 Astacin 55..251 CDD:279708 62/205 (30%)
ZnMc_astacin_like 59..249 CDD:239807 59/199 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444834
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6774
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D122071at6656
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.