DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and CG10280

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001246942.1 Gene:CG10280 / 40740 FlyBaseID:FBgn0037395 Length:362 Species:Drosophila melanogaster


Alignment Length:196 Identity:67/196 - (34%)
Similarity:104/196 - (53%) Gaps:14/196 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 WKGRTLVYSYAGGFSSLDIASIESAMAEISSKTCVKFRRTEYKREPQVVIQK--EG-SGCWSYVG 117
            |...|:.:..:..:::.:..:|..|:...:|.|||.|...:.:.:..::|:.  || .|||||||
  Fly   149 WPNGTIPFEISPRYANQERQAIIQAVKTFNSLTCVHFVPYDGEVDDYLLIEPPLEGPQGCWSYVG 213

  Fly   118 YLGRADQTLNL------GSGCMSNR-TIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHN 175
            ..| .:|.::|      .:.|.|:. .|.|||:||:|.:|..|...||.:|:|..|||......|
  Fly   214 RRG-GEQVVSLQRPDENSAHCFSSEGRIMHELMHAIGIYHEQSRADRDNFVKIHWDNIVPRFRKN 277

  Fly   176 FQRLRANGVTNYGFGYDYDSIMHYGPFAFSK-NGQS-TIVPLKSHAKIGQATQMSPKDVQTLKRM 238
            | :|.:.....|.|.|||:|:||||.|.||| .|:. |:.||:...:|||...:|..|...:..:
  Fly   278 F-KLVSKKKGKYAFDYDYNSVMHYGEFYFSKRKGEKPTMTPLQPGVRIGQRKTISKIDCLKINEL 341

  Fly   239 Y 239
            |
  Fly   342 Y 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 66/194 (34%)
ZnMc_astacin_like 58..239 CDD:239807 65/192 (34%)
CG10280NP_001246942.1 Astacin 147..344 CDD:279708 67/196 (34%)
ZnMc_astacin_like 151..342 CDD:239807 65/192 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444819
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115954at6960
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.