DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and CG15253

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster


Alignment Length:253 Identity:92/253 - (36%)
Similarity:130/253 - (51%) Gaps:24/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HYLALAVIFGLGSSANGRPSIKLQEDDIILISEQLQYFEGNLEGRVVKSWSE--------YYWKG 58
            :|..|.::..:.:.|...|||:::.|.        :...|.:||.:|.|.|.        |.|..
  Fly     3 YYSILLLLLVVVNVAWAAPSIRIETDP--------ELTAGYIEGDMVPSGSSRNIWRNETYRWPN 59

  Fly    59 RTLVYSYAGGFSSLDIASIESAMAEISSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRAD 123
            |.:.|.............|.||:.:|.|.:|:.|:.....::..|.:..|..||:||:|||.|..
  Fly    60 RIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQ 124

  Fly   124 QTLNL-----GSGCMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANG 183
            | |||     |.||....||.||.||||||||..|...||.||:|..:||..|.|.||.:.....
  Fly   125 Q-LNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEET 188

  Fly   184 VTNYGFGYDYDSIMHYGPFAFSKNGQSTIVPLKSHAK--IGQATQMSPKDVQTLKRMY 239
            |.::|..|||.|:|||||:||||||:.||:.|:...:  |||..::|..|::.|..:|
  Fly   189 VNDFGEKYDYGSVMHYGPYAFSKNGERTILALEEGKEDVIGQRLELSETDIRKLNAIY 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 77/189 (41%)
ZnMc_astacin_like 58..239 CDD:239807 76/187 (41%)
CG15253NP_609758.1 Astacin 55..250 CDD:279708 79/193 (41%)
ZnMc_astacin_like 59..246 CDD:239807 76/187 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444826
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D109979at50557
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.