DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and Semp1

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster


Alignment Length:218 Identity:81/218 - (37%)
Similarity:118/218 - (54%) Gaps:18/218 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 YFEGNLEGRVVKSWSE-----YYWKGRTLVYSYA-GGFSSLDIASIESAMAEISSKTCVKFR-RT 95
            :::|:::...:::.:.     |:|..||:.|... ..|:......|..|::.|...:||.|: .|
  Fly    30 FYQGDIKAHPIRTRNGIVNQIYHWPNRTVPYMIEDDAFADSHYREILRAISIIEENSCVIFKPAT 94

  Fly    96 EYKREPQVVIQKEGSGCWS-YVGYLGRADQTLN-----LGSGCMSNRTIQHELLHALGFFHTHSD 154
            |......:||..:|.||.: ::||..:. |.:|     ||.||....:|.|||||.|||.|.|..
  Fly    95 EMDFPMALVITSKGLGCNTVHLGYRNKT-QVVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVS 158

  Fly   155 PQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGF--GYDYDSIMHYGPFAFSKNGQSTIVPLKS 217
            ..||:||.||..||...:..||.. ..|....:.|  ||||:|:|||.|.|||:|||.|||||:.
  Fly   159 QNRDQYVSIQWKNINPQYNINFVN-NDNSTAWHDFDEGYDYESVMHYVPRAFSRNGQPTIVPLRE 222

  Fly   218 HAK-IGQATQMSPKDVQTLKRMY 239
            .|: :||...||.||::.|.:||
  Fly   223 GAENMGQRFYMSEKDIRKLNKMY 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 77/193 (40%)
ZnMc_astacin_like 58..239 CDD:239807 76/191 (40%)
Semp1NP_609756.1 Astacin 53..249 CDD:279708 79/195 (41%)
ZnMc_astacin_like 55..245 CDD:239807 76/191 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469024
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D109979at50557
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.