DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and CG6696

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster


Alignment Length:217 Identity:88/217 - (40%)
Similarity:120/217 - (55%) Gaps:10/217 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LQEDDIILISEQLQYFEGNLEGRVVKSWSEYYWKGRTLVYSYAGGFSSLDIASIESAMAEISSKT 88
            |.|.||:|..|.|:  .|.|..|:  :|.|    .....|.....|::.....|..|..|...:|
  Fly    82 LFEGDIMLHRELLR--NGLLNERL--TWPE----AAVPFYIDPQDFNANQTMVILKAFKEYHDRT 138

  Fly    89 CVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRADQTLNLGS-GCMSNRTIQHELLHALGFFHTH 152
            |::||..|...:..::|:...|||||.||... ..|.|||.: .|:::..:.|||||||||:|..
  Fly   139 CIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRS-GGQVLNLNTPKCVTHGVVVHELLHALGFYHQQ 202

  Fly   153 SDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKNGQSTIVPLKS 217
            |..:||:||:|..:||..||.|||.:.....:||:|..|||.|:|||...||||||::||.||..
  Fly   203 SATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATIEPLDP 267

  Fly   218 HAKIGQATQMSPKDVQTLKRMY 239
            :|.:||...:|.|||..|..||
  Fly   268 YASLGQRRGLSDKDVSKLNEMY 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 74/183 (40%)
ZnMc_astacin_like 58..239 CDD:239807 74/181 (41%)
CG6696NP_573318.1 Astacin 104..295 CDD:279708 78/191 (41%)
ZnMc_astacin_like 110..289 CDD:239807 74/179 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444817
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6774
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D109979at50557
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.