DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and mep1bb

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_009294699.1 Gene:mep1bb / 327586 ZFINID:ZDB-GENE-030131-5797 Length:774 Species:Danio rerio


Alignment Length:227 Identity:79/227 - (34%)
Similarity:114/227 - (50%) Gaps:20/227 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EDDIILISEQ--LQYFEGNL-----EGRVVKSWSEYYWKGRTLVYSYAGGFSSLDIAS---IESA 80
            ::|:..::|.  |..|||::     .||......||.|. :|:.|.:.   ..|:|.:   |..|
Zfish    46 KEDLFDVNEDAGLDLFEGDILYDETLGRNSIIGEEYRWP-KTIPYYFE---DDLEINAKGVILKA 106

  Fly    81 MAEISSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRADQTLNLGSGCMSNRTIQHELLHA 145
            ..:...|||:.::  .:..|...:...:|:||:|.||......|||::||||....||:||.|||
Zfish   107 FEQYRLKTCIDYK--PWTGEENYISVFKGNGCFSSVGNRRVGRQTLSIGSGCDRIATIEHEFLHA 169

  Fly   146 LGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKNGQS 210
            |||:|..|...||.||.|..|.|..|.||||.:...:..:.....|||.|:|||...||....:.
Zfish   170 LGFWHEQSRSDRDDYVSIMWDRITEGKEHNFNKYNDSSSSALNVPYDYSSMMHYSQKAFQSGSEP 234

  Fly   211 TI---VPLKSHAKIGQATQMSPKDVQTLKRMY 239
            ||   :|..| :.|||..:.|..|:..|.|:|
Zfish   235 TIITRIPAFS-SVIGQRMEFSDSDLLKLNRLY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 68/188 (36%)
ZnMc_astacin_like 58..239 CDD:239807 67/186 (36%)
mep1bbXP_009294699.1 ZnMc 39..267 CDD:294052 79/227 (35%)
Astacin 81..269 CDD:279708 70/192 (36%)
MAM 277..441 CDD:279023
MAM 277..440 CDD:99706
MATH 440..608 CDD:295307
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.