DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and Mep1b

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_037315.1 Gene:Mep1b / 25727 RGDID:3081 Length:704 Species:Rattus norvegicus


Alignment Length:222 Identity:77/222 - (34%)
Similarity:105/222 - (47%) Gaps:11/222 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EDDIILISEQ--LQYFEGNLE----GRVVKSWSEYYWKGRTLVYSYAGGFSSLDIASIESAMAEI 84
            :.||..|:|.  |..|||:::    ||.......|.|. .|:.|.............|.:|....
  Rat    36 DQDIFDINEDLGLDLFEGDIKLEASGRNSIIGDNYRWP-HTIPYVLEDSLEMNAKGVILNAFERY 99

  Fly    85 SSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRADQTLNLGSGCMSNRTIQHELLHALGFF 149
            ..|||:.|:  .:..|...:...:||||||.||.:....|.|::|:.|....|:|||.||||||:
  Rat   100 RLKTCIDFK--PWSGEENYISVFKGSGCWSSVGNIHAGKQELSIGTNCDRIATVQHEFLHALGFW 162

  Fly   150 HTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKNGQSTIVP 214
            |..|...||.|:.|..|.|.||.||||.....:...:....|||.|:|||...||....:|||:.
  Rat   163 HEQSRADRDDYITIVWDRILSGKEHNFNIYNDSVSDSLNVPYDYTSVMHYSKTAFQNGTESTIIT 227

  Fly   215 LKSHAK--IGQATQMSPKDVQTLKRMY 239
            ..|..:  |||....|..|:..|.::|
  Rat   228 KISDFEDVIGQRMDFSDYDLLKLNQLY 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 65/184 (35%)
ZnMc_astacin_like 58..239 CDD:239807 64/182 (35%)
Mep1bNP_037315.1 ZnMc 30..256 CDD:294052 77/222 (35%)
Astacin 70..258 CDD:279708 67/188 (36%)
MAM 266..430 CDD:279023
MAM 266..428 CDD:99706
MATH 428..586 CDD:295307
EGF_CA 609..647 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.