Sequence 1: | NP_609759.1 | Gene: | CG11865 / 34917 | FlyBaseID: | FBgn0028947 | Length: | 240 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036034.1 | Gene: | Tll2 / 24087 | MGIID: | 1346044 | Length: | 1012 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 70/200 - (35%) |
---|---|---|---|
Similarity: | 102/200 - (51%) | Gaps: | 8/200 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 RVVKSWSEYYWKGRTLVYSYAGGFSSLDIASIESAMAEISSKTCVKF-RRTEYKREPQVVIQKEG 109
Fly 110 SGCWSYVGYLGRADQTLNLGSGCMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEH 174
Fly 175 NFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKN-GQSTIVPLKS----HAKIGQATQMSPKDVQT 234
Fly 235 LKRMY 239 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11865 | NP_609759.1 | Astacin | 56..239 | CDD:279708 | 66/188 (35%) |
ZnMc_astacin_like | 58..239 | CDD:239807 | 65/186 (35%) | ||
Tll2 | NP_036034.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 83..135 | ||
ZnMc_BMP1_TLD | 147..346 | CDD:239808 | 68/198 (34%) | ||
Astacin | 154..347 | CDD:279708 | 66/191 (35%) | ||
CUB | 348..457 | CDD:278839 | |||
CUB | 461..570 | CDD:278839 | |||
FXa_inhibition | 581..613 | CDD:291342 | |||
CUB | 617..726 | CDD:278839 | |||
FXa_inhibition | 733..768 | CDD:291342 | |||
CUB | 773..882 | CDD:278839 | |||
CUB | 886..999 | CDD:278839 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |