DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and Tnfaip6

DIOPT Version :10

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_033424.1 Gene:Tnfaip6 / 21930 MGIID:1195266 Length:275 Species:Mus musculus


Alignment Length:97 Identity:20/97 - (20%)
Similarity:38/97 - (39%) Gaps:11/97 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 YLGRADQTLNLGSGCMSNRT---IQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRL 179
            :|...|..|....||:::..   ..::.:|  ||...:...:      :..|.|.:|:....:.|
Mouse   174 HLSFLDFDLEHDPGCLADYVEIYDSYDDVH--GFVGRYCGDE------LPEDIISTGNVMTLKFL 230

  Fly   180 RANGVTNYGFGYDYDSIMHYGPFAFSKNGQST 211
            ....||..||...|.::......:.:||..:|
Mouse   231 SDASVTAGGFQIKYVTVDPASKSSQAKNTSTT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 ZnMc_astacin_like 58..239 CDD:239807 20/97 (21%)
Tnfaip6NP_033424.1 Link_domain_TSG_6_like 36..128 CDD:239592
CUB 135..244 CDD:395345 16/77 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..275 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.