DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11865 and nas-5

DIOPT Version :9

Sequence 1:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_492616.1 Gene:nas-5 / 188819 WormBaseID:WBGene00003524 Length:360 Species:Caenorhabditis elegans


Alignment Length:262 Identity:68/262 - (25%)
Similarity:121/262 - (46%) Gaps:33/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LALAVIFGLG------SSANGRPSIKLQEDDIILI---SEQLQY----------FEGNLEGRVVK 49
            |.::|:.|.|      .:.||:       .||:.:   :|||.|          |...|......
 Worm    12 LTVSVVNGRGRRINIYGAENGK-------SDIVQLRGPAEQLVYSSPIRERRPIFRNALLSNSPL 69

  Fly    50 SWSEYY-WKGRTLV-YSYAGGFSSLDIASIESAMAEISSKTCVKFRRTEYKREPQVVIQKEGSGC 112
            .||:.. ..|..|: |..:|.:.:::..:|::||.:|::.||::......:.:...:..|:|.||
 Worm    70 RWSKMQDLDGNYLIPYVISGNYDTVERDTIKTAMEKIANNTCIRLIPRTNQPDYAEINNKKGQGC 134

  Fly   113 WSYVG-YLGRADQTL--NLGSGCMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEH 174
            ::.:| :.|:....|  |....|:...|:.|||.|.:|.:|.|....||.::.:...||......
 Worm   135 YASIGRFPGKNVVMLESNDDQSCIQEDTVIHELFHVIGLWHEHMRADRDAFINVLYKNIEPAQYP 199

  Fly   175 NFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKNGQSTIVPLKSHAK--IGQATQMSPKDVQTLKR 237
            .|::|.:...|.|...|||:|:|||...||:|.|:.:::...|..:  ||.....|..|.:.:..
 Worm   200 QFEKLSSRDATTYSVPYDYNSVMHYDENAFAKPGKISMMTKDSKFQKVIGHPKDASSNDYKKVCA 264

  Fly   238 MY 239
            :|
 Worm   265 IY 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11865NP_609759.1 Astacin 56..239 CDD:279708 51/188 (27%)
ZnMc_astacin_like 58..239 CDD:239807 51/186 (27%)
nas-5NP_492616.1 ZnMc_astacin_like 80..266 CDD:239807 50/185 (27%)
Astacin 83..269 CDD:279708 50/184 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.